monro-v2wja9

Moniliophthora roreri (strain MCA 2997) (Cocoa frosty pod rot fungus) (Crinipellis roreri). Esterase lipase

Comment

Relationship

Family : Hormone-sensitive_lipase_like

Block : H

Position in NCBI Life Tree : Moniliophthora roreri

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

IAAGIPPVPARDTPPSAVELRQTFGAEILKGIKATYDPQV
PPDSEYQLTD RQIDVDGAQVLCRCIVPTARTGEDKFPLL
FWTHGGGWVIGELAWDDSRLR RLAVDRRIAVVNCEYRLA
PEHPFPIPVNDSCACLKYFAAHPELVSADLSK GFLVAGI
SAGGNLAAVLAHLARDDPFFKEKPITGQLLSIPVTLHPDV
YPE EQVFPHLFLLISFEQNKDALLLTAQGMREMWNFYNS
DPLDPKASPVLLPS HAGLAPAYVQVCGQDPLRDEGLLYE
KLLREAGVKTKLEIYPGVPHGFDIV APNISLGKKYSADI
GNGIQWLLQGV

References

Title : Genome and secretome analysis of the hemibiotrophic fungal pathogen, Moniliophthora roreri, which causes frosty pod rot disease of cacao: mechanisms of the biotrophic and necrotrophic phases - Meinhardt_2014_BMC.Genomics_15_164
Author(s) : Meinhardt LW , Costa GG , Thomazella DP , Teixeira PJ , Carazzolle MF , Schuster SC , Carlson JE , Guiltinan MJ , Mieczkowski P , Farmer A , Ramaraj T , Crozier J , Davis RE , Shao J , Melnick RL , Pereira GA , Bailey BA
Ref : BMC Genomics , 15 :164 , 2014
Abstract : Meinhardt_2014_BMC.Genomics_15_164
ESTHER : Meinhardt_2014_BMC.Genomics_15_164
PubMedSearch : Meinhardt_2014_BMC.Genomics_15_164
PubMedID: 24571091
Gene_locus related to this paper: monro-v2wn76 , monro-v2xuz8 , monro-v2xl67 , monro-v2xnp4 , monro-v2wv67 , monro-v2wja9