sacen-a4fn55

Saccharopolyspora erythraea (strain NRRL 23338) Dienelactone hydrolase

Comment

Relationship

Family : DLH-S

Block : X

Position in NCBI Life Tree : Saccharopolyspora erythraea

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAHLTAEPVEMRVATGTLNGDLVVPPAAEAVVLFAHGSGS
SRHSPRNRAV AEALQNTGFATMLLDLLTTDEANTDDRTQ
ALRFDIDLLTDRVVTAVDWLE QRQATRGMPVGLFGASTG
AAAALKGASRRPGRVAAVVSRGGRPDLSGEAL SSVQAPT
LLIVGGDDREVLELNRHAAKLLTSLPLTDVQIEIVQHAGH
LFE EPGALEKVSDLAAGWFRRYLGVPRPEGPTGTHVKPP
EPVRRGVNR

References