sacen-a4ff15

Saccharopolyspora erythraea (strain NRRL 23338) Non-heme chloroperoxidase

Comment

Relationship

Family : Haloperoxidase

Block : X

Position in NCBI Life Tree : Saccharopolyspora erythraea

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MGVITTKDGTEIFYKDWGSGRPVVFSHGWPLSADAWDDQM
VLVASRGFRA IAHDRRGHGRSEQPWSGNDMDTYADDLAA
LLDVLALENAVLVGHSTGGGE VTRYIGRHGTARVAGAVL
LSAVPPLMLRTEHNPGGLPIDVFDEMRTGVAA DRSQFYR
DLSEPFYGANRPGSAVSQGLREAFWLMSMQVGLNAALECI
RAF SETDFTDDLRRIDVPTLILHGDDDQIVPIDASARKS
AELVRGATLKVYPG ASHGLAATPEYKDAFNSDLLEFISF

References