strag-a0a076z217

Streptococcus agalactiae. Uncharacterized protein

Comment

"Other strains: Streptococcus sp. Streptococcus agalactiae (ATCC 13813 \/ DSM 2134 \/ JCM 5671 \/ NCIMB 701348 \/ NCTC 8181\; ATCC BAA-611 \/ 2603 V\/R\; NEM316\; FSL S3-026\; serotype V\; serotype III\; FSL S3-170\; FSL C1-494\; FSL C1-487\; FSL S3-586\; FSL S3-251)"

Relationship

Family : Asp2

Block : X

Position in NCBI Life Tree : Streptococcus agalactiae

Molecular evidence

No mutation

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MSKIKLTILQVGEENWATKENIPNNMEWLFIKPDQISDFV
TTENNYLTSS KLLQKLPRKISALLLTEQTYGPELSSLSS
FFEVYEVFYPKDKHATGITEE FLRSKMAQRYDSSSPDQL
IRQFYKGLFIGQYGEKLQVSQIQIRNDFEGVV NYQGNNY
LELEGQFGENYSFLLNFAYNIPFSSDFYNELFLEHIIEGD
IDI RLVISLIVDGSVDDIAKEWYFEKEDLNQLISLESDI
SGSLAVKLFAKGKG IVKLGPLHRRNGRGGLGTFLLGGER
HIDAIGHEFMTYFDPVDFKPPLTVY FSGFRSAEGFEGFW
MMKSMKTPFMLICDPRLQGGAFYIGSKEYEQKIVDA IQE
KLAFLNFSSDQLILSGLSMGTYGATYHGAKLNPHAIIIGK
PIFNLGT VAQRERLERPDGFATSLDIQLLNQGDLTSSSS
EKLNNYFWKSIEEGDFSN TTFALAYMKNDDYDATAFSDL
LQYFRGKKHKILGRGWDGRHGDCSAEVGA WFTSQYRRML
SNDFGRKEE

References

Title : Genomic analysis reveals the molecular basis for capsule loss in the group B Streptococcus population - Rosini_2015_PLoS.One_10_e0125985
Author(s) : Rosini R , Campisi E , De Chiara M , Tettelin H , Rinaudo D , Toniolo C , Metruccio M , Guidotti S , Sorensen UB , Kilian M , Ramirez M , Janulczyk R , Donati C , Grandi G , Margarit I
Ref : PLoS ONE , 10 :e0125985 , 2015
Abstract : Rosini_2015_PLoS.One_10_e0125985
ESTHER : Rosini_2015_PLoS.One_10_e0125985
PubMedSearch : Rosini_2015_PLoS.One_10_e0125985
PubMedID: 25946017
Gene_locus related to this paper: strag-a0a076z217 , strag-a0a0h1ywg1

Title : vanG element insertions within a conserved chromosomal site conferring vancomycin resistance to Streptococcus agalactiae and Streptococcus anginosus - Srinivasan_2014_MBio_5_e01386
Author(s) : Srinivasan V , Metcalf BJ , Knipe KM , Ouattara M , McGee L , Shewmaker PL , Glennen A , Nichols M , Harris C , Brimmage M , Ostrowsky B , Park CJ , Schrag SJ , Frace MA , Sammons SA , Beall B
Ref : MBio , 5 :e01386 , 2014
Abstract : Srinivasan_2014_MBio_5_e01386
ESTHER : Srinivasan_2014_MBio_5_e01386
PubMedSearch : Srinivasan_2014_MBio_5_e01386
PubMedID: 25053786
Gene_locus related to this paper: strag-a0a076z217

Title : The accessory Sec protein Asp2 modulates GlcNAc deposition onto the serine-rich repeat glycoprotein GspB - Seepersaud_2012_J.Bacteriol_194_5564
Author(s) : Seepersaud R , Bensing BA , Yen YT , Sullam PM
Ref : Journal of Bacteriology , 194 :5564 , 2012
Abstract : Seepersaud_2012_J.Bacteriol_194_5564
ESTHER : Seepersaud_2012_J.Bacteriol_194_5564
PubMedSearch : Seepersaud_2012_J.Bacteriol_194_5564
PubMedID: 22885294
Gene_locus related to this paper: strag-a0a076z217 , strgn-asp2