vigra-Vreh3

Vigna radiata (Mung bean) Epoxide hydrolase Vreh3

Comment

Relationship

Family : Epoxide_hydrolase

Block : X

Position in NCBI Life Tree : Vigna radiata

Molecular evidence

No mutation

No kinetic

No disease

No inhibitor

Database

Sequence

Peptide

MEGVEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSW
RHQILALSSR GYRAVAPDLRGYGDTEAPVSISSYTGFHI
VGDLIALIDLLGVDQVFLVAH DWGAIIGWYLCTFRPDRV
KAYVCLSVPLLHRDPNIRTVDAMRAMYGDDYY ICRFQKP
GEMEAQMAEVGTEYVLKNILTTRKPGPPIFPKGEYGTGFN
PDM PNSLPSWLTQDDLAYYVSKYEKTGFTGPLNYYRNMN
LNWELTAPWSGGKI QVPVKFITGELDMVYTSLNMKEYIH
GGGFKQDVPNLEEVIVQKNVAHFNN QEAAEEINNHIYDF
IKKF

References

Title : Reprogramming Epoxide Hydrolase to Improve Enantioconvergence in Hydrolysis of Styrene Oxide Scaffolds - Li_2021_Adv.Synth.Catal_362_4699
Author(s) : Li FL , Qiu YY , Zheng YC , Chen FF , Kong XD , Xu JH , Yu HL
Ref : Adv Synth Catal , 362 :4699 , 2021
Abstract : Li_2021_Adv.Synth.Catal_362_4699
ESTHER : Li_2021_Adv.Synth.Catal_362_4699
PubMedSearch : Li_2021_Adv.Synth.Catal_362_4699
PubMedID:
Gene_locus related to this paper: vigra-Vreh3

Title : Regioselectivity Engineering of Epoxide Hydrolase: Near-Perfect Enantioconvergence through a Single Site Mutation - Li_2018_ACS.Catal_8_8314
Author(s) : Li FL , Kong XD , Chen Q , Zheng YC , Xu Q , Chen FF , Fan LQ , Lin GQ , Zhou J , Yu HL , Xu JH
Ref : ACS Catal , 8 :8314 , 2018
Abstract : Li_2018_ACS.Catal_8_8314
ESTHER : Li_2018_ACS.Catal_8_8314
PubMedSearch : Li_2018_ACS.Catal_8_8314
PubMedID:
Gene_locus related to this paper: vigra-Vreh3

Title : Stereoselective Hydrolysis of Epoxides by reVrEH3, a Novel Vigna radiata Epoxide Hydrolase with High Enantioselectivity or High and Complementary Regioselectivity - Hu_2017_J.Agric.Food.Chem_65_9861
Author(s) : Hu D , Tang C , Li C , Kan T , Shi X , Feng L , Wu M
Ref : Journal of Agricultural and Food Chemistry , 65 :9861 , 2017
Abstract : Hu_2017_J.Agric.Food.Chem_65_9861
ESTHER : Hu_2017_J.Agric.Food.Chem_65_9861
PubMedSearch : Hu_2017_J.Agric.Food.Chem_65_9861
PubMedID: 29058432
Gene_locus related to this paper: vigra-Vreh3

Title : Enantioconvergent hydrolysis of racemic styrene oxide at high concentration by a pair of novel epoxide hydrolases into (R)-phenyl-1,2-ethanediol - Wang_2017_Biotechnol.Lett_39_1917
Author(s) : Wang R , Hu D , Zong X , Li J , Ding L , Wu M
Ref : Biotechnol Lett , 39 :1917 , 2017
Abstract : Wang_2017_Biotechnol.Lett_39_1917
ESTHER : Wang_2017_Biotechnol.Lett_39_1917
PubMedSearch : Wang_2017_Biotechnol.Lett_39_1917
PubMedID: 28875350
Gene_locus related to this paper: vigra-Vreh3 , aspng-q1ktb5

Title : Use of hydrophilic ionic liquids in a two-phase system to improve Mung bean epoxide hydrolases-mediated asymmetric hydrolysis of styrene oxide - Chen_2012_J.Biotechnol_162_183
Author(s) : Chen WJ , Lou WY , Yu CY , Wu H , Zong MH , Smith TJ
Ref : J Biotechnol , 162 :183 , 2012
Abstract : Chen_2012_J.Biotechnol_162_183
ESTHER : Chen_2012_J.Biotechnol_162_183
PubMedSearch : Chen_2012_J.Biotechnol_162_183
PubMedID: 22995740
Gene_locus related to this paper: vigra-Vreh3