Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9baci-a0a060lzd7

Bacillus lehensis; Bacillus sp. Carboxylesterase

Comment
Other strains: Bacillus lehensis G1; Bacillus sp. (JCM 19047; JCM 19046; JCM 19045)


Relationship
Family|CarbLipBact_1
Block| X
Position in NCBI Life Tree|Bacillus lehensis G1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus lehensis: N E > Bacillus lehensis G1: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: CP003923, BAWC01000010, BAWB01000024
>3 UniProt links 1 more: A0A060LZD7, W7ZNY5, W7ZBM3
>3 UniProt links 1 more: A0A060LZD7, W7ZNY5, W7ZBM3
>3 Interpro links 1 more: A0A060LZD7, W7ZNY5, W7ZBM3
>3 Pfam links 1 more: A0A060LZD7, W7ZNY5, W7ZBM3
>3 PIRSF links 1 more: A0A060LZD7, W7ZNY5, W7ZBM3
>3 SUPERFAM links 1 more: A0A060LZD7, W7ZNY5, W7ZBM3
Sequence
Graphical view for this peptide sequence: 9baci-a0a060lzd7
Colored MSA for CarbLipBact_1 (raw)
MKIVAPKPFTFKGGKRAVLLLHGFTGTTADVRMLGRFLQNEGYTCHAPLY
RGHGVPPEELVQYSPADWWEDVEAAYEHLQTEGYDEIAVCGLSLGGVFTL
KLGYSKPVKGIVSMCAPVRPRTEEAIKEGFLKYAKEYKQLEKKPEEEIDK
DLLALKETSMNTLYQLRGLMDDVRKELDLIYSPAFIVQARQDEMIDIESA
NMIYEEIETDDKELKWYEESTHVITLGDEKETLHQDILSFLNELEWSN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKIVAPKPFTFKGGKRAVLLLHGFTGTTADVRMLGRFLQNEGYTCHAPLY
RGHGVPPEELVQYSPADWWEDVEAAYEHLQTEGYDEIAVCGLSLGGVFTL
KLGYSKPVKGIVSMCAPVRPRTEEAIKEGFLKYAKEYKQLEKKPEEEIDK
DLLALKETSMNTLYQLRGLMDDVRKELDLIYSPAFIVQARQDEMIDIESA
NMIYEEIETDDKELKWYEESTHVITLGDEKETLHQDILSFLNELEWSN


References
    Title: Draft Genome Sequences of Cyclodextrin-Producing Alkaliphilic Bacillus Strains JCM 19045, JCM 19046, and JCM 19047
    Kudo T, Sakamoto K, Akinaga M, Kawauchi A, Nakahara T, Zhang X, Yamada A, Oshima K, Suda W and Ohkuma M <10 more author(s)>
    Ref: Genome Announc, 2:, 2014 : PubMed

            

    Title: A comparative genomic analysis of the alkalitolerant soil bacterium Bacillus lehensis G1
    Noor YM, Samsulrizal NH, Jema'on NA, Low KO, Ramli AN, Alias NI, Damis SI, Fuzi SF, Isa MN and Illias RM <5 more author(s)>
    Ref: Gene, 545:253, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer