Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-b4cy19

Chthoniobacter flavus Ellin428 Putative uncharacterized protein

Relationship
Family|Pectin_methylesterase
Block| X
Position in NCBI Life Tree|Chthoniobacter flavus Ellin428
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > PVC group: N E > Verrucomicrobia: N E > Spartobacteria: N E > Chthoniobacterales: N E > Chthoniobacteraceae: N E > Chthoniobacter: N E > Chthoniobacter flavus: N E > Chthoniobacter flavus Ellin428: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ABVL01000003
1 UniProt : B4CY19
1 UniProt : B4CY19
1 Interpro : B4CY19
1 Pfam : B4CY19
1 PIRSF : B4CY19
1 SUPERFAM : B4CY19
Sequence
Graphical view for this peptide sequence: 9bact-b4cy19
Colored MSA for Pectin_methylesterase (raw)
EVWARRAEEVRMQVKVALGVWPEPTRTPLNPVVYGKIEGDGYTIEKVYFE
SMPGFFVTGSLFRPRTEGKHPVVLCPHGHWTDARFIVRGDAEMKKELDSG
GERSLESGRSMFQSLGIQLARMGMVAFVYDMLGNSDSQQISRELAHGFAK
QRPEMNTAENWGLFSPQAETHVESIAGLQTWNSIRSIDFLTSLPDVDASR
IGVTGASGGGTQTMLLSAVDPRVTVECPAVMVSTAMQGGCTCENASLLRV
NTGNIEFAALFAPKPLGMTAANDWTKEMETKGFPELQRHYAMMGAPNNVT
LWPHLNFGHNYNVVSRENIYAWFNEHFHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

EVWARRAEEVRMQVKVALGVWPEPTRTPLNPVVYGKIEGDGYTIEKVYFE
SMPGFFVTGSLFRPRTEGKHPVVLCPHGHWTDARFIVRGDAEMKKELDSG
GERSLESGRSMFQSLGIQLARMGMVAFVYDMLGNSDSQQISRELAHGFAK
QRPEMNTAENWGLFSPQAETHVESIAGLQTWNSIRSIDFLTSLPDVDASR
IGVTGASGGGTQTMLLSAVDPRVTVECPAVMVSTAMQGGCTCENASLLRV
NTGNIEFAALFAPKPLGMTAANDWTKEMETKGFPELQRHYAMMGAPNNVT
LWPHLNFGHNYNVVSRENIYAWFNEHFHL


Reference
    Title: Genome sequence of Chthoniobacter flavus Ellin428, an aerobic heterotrophic soil bacterium
    Kant R, van Passel MW, Palva A, Lucas S, Lapidus A, Glavina Del Rio T, Dalin E, Tice H, Bruce D and Smidt H <8 more author(s)>
    Ref: Journal of Bacteriology, 193:2902, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer