Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-m4pza5

uncultured bacterium SRF2. Uncharacterized protein

Relationship
Family|Duf_3089
Block| X
Position in NCBI Life Tree|uncultured bacterium SRF2
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium SRF2: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : JX163905
1 UniProt : M4PZA5
1 UniProt : M4PZA5
1 Interpro : M4PZA5
1 Pfam : M4PZA5
1 PIRSF : M4PZA5
1 SUPERFAM : M4PZA5
Sequence
Graphical view for this peptide sequence: 9bact-m4pza5
Colored MSA for Duf_3089 (raw)
MLVVAILVQSYKNLSIYSYLCTKILRGAMKSGLKTAFLTLWAIMGTGCAI
HSVAIQQESEPLVAGPVPPAPDYADSTQWYIRDRGADVDLFYIISTETGF
HMTGTDTCHFADTHDDYLRGRMRHEMHAVDSFYSGGLNYFSPYYRQVSMQ
SWAHQETAFARLPLALYDCRRSWDYYIKHLNHGRPFIIAGFSQGAHAMMD
VMRHMPDSLAKRMVAFYCIGYKVTAEDTAACRLLRPAKGATDTGITICFN
SVKALESEIDVVSKGNLFCINPVNWRTDTVPAPFVNYGRKKNDTLTAQLD
PESRLLFISGYADDKPMAVIGKPGNYHNMELKFFYPYIRQNMADRVAAFM
AKKEE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLVVAILVQSYKNLSIYSYLCTKILRGAMKSGLKTAFLTLWAIMGTGCAI
HSVAIQQESEPLVAGPVPPAPDYADSTQWYIRDRGADVDLFYIISTETGF
HMTGTDTCHFADTHDDYLRGRMRHEMHAVDSFYSGGLNYFSPYYRQVSMQ
SWAHQETAFARLPLALYDCRRSWDYYIKHLNHGRPFIIAGFSQGAHAMMD
VMRHMPDSLAKRMVAFYCIGYKVTAEDTAACRLLRPAKGATDTGITICFN
SVKALESEIDVVSKGNLFCINPVNWRTDTVPAPFVNYGRKKNDTLTAQLD
PESRLLFISGYADDKPMAVIGKPGNYHNMELKFFYPYIRQNMADRVAAFM
AKKEE


Reference
    Title: Microbial beta-glucosidases from cow rumen metagenome enhance the saccharification of lignocellulose in combination with commercial cellulase cocktail
    Del Pozo MV, Fernandez-Arrojo L, Gil-Martinez J, Montesinos A, Chernikova TN, Nechitaylo TY, Waliszek A, Tortajada M, Rojas A and Golyshin PN <5 more author(s)>
    Ref: Biotechnol Biofuels, 5:73, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer