Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9hypo-a0a167hq40

Beauveria brongniartii; Beauveria bassiana; Beauveria bassiana (White muscardine disease fungus) (Tritirachium shiotae). BEM46 family protein

Comment
Other strains: Beauveria brongniartii RCEF 3172; Beauveria bassiana D1-5.; Beauveria bassiana (strain ARSEF 2860) (White muscardine disease fungus) (Tritirachium shiotae)


Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Beauveria brongniartii RCEF 3172
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Cordycipitaceae: N E > Beauveria: N E > Cordyceps brongniartii: N E > Cordyceps brongniartii RCEF 3172: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: 9hypo-a0a167hq40
Colored MSA for ABHD13-BEM46 (raw)
MSNSNSSPSTLTGYLEQTASVLSSVASYMKLPALASTGIAAILTSLLYFK
QKALIYPSHMPANSRTDVPRPSQFGIRDFEELVIPTDDGEKLSAFYIRGP
RDHKNSRVTILMFHGNAGNIGHRLPIARMILNTTGCNVFMLEYRGYGTST
GEPDESGLNIDAQTGLNYLRDRAETRHHSYFIFGQSLGGAVGIKLASKNQ
SRGDVAGLILENTFLSMRKLIPSVIPPAKYLTLLCHQVWASESVLPTIDK
VPILFISGLQDEIVPPEHMKRLFEISAAPSKVWKPLPGGDHNSSVLEEGY
FEAIQEFVNETMAEHIKEEKGP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNSNSSPSTLTGYLEQTASVLSSVASYMKLPALASTGIAAILTSLLYFK
QKALIYPSHMPANSRTDVPRPSQFGIRDFEELVIPTDDGEKLSAFYIRGP
RDHKNSRVTILMFHGNAGNIGHRLPIARMILNTTGCNVFMLEYRGYGTST
GEPDESGLNIDAQTGLNYLRDRAETRHHSYFIFGQSLGGAVGIKLASKNQ
SRGDVAGLILENTFLSMRKLIPSVIPPAKYLTLLCHQVWASESVLPTIDK
VPILFISGLQDEIVPPEHMKRLFEISAAPSKVWKPLPGGDHNSSVLEEGY
FEAIQEFVNETMAEHIKEEKGP


References
    Title: Divergent and Convergent Evolution of Fungal Pathogenicity
    Shang Y, Xiao G, Zheng P, Cen K, Zhan S, Wang C
    Ref: Genome Biol Evol, 8:1374, 2016 : PubMed

            

    Title: Genomic perspectives on the evolution of fungal entomopathogenicity in Beauveria bassiana
    Xiao G, Ying SH, Zheng P, Wang ZL, Zhang S, Xie XQ, Shang Y, St Leger RJ, Zhao GP and Feng MG <1 more author(s)>
    Ref: Sci Rep, 2:483, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer