Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9neis-e1apk1

Chromobacterium sp. USM2 phaC(pha synthase) Intracellular polyhydroxyalkanoate synthase

Relationship
Family|PHA_synth_I
Block| X
Position in NCBI Life Tree|Chromobacterium sp. USM2
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Neisseriales: N E > Chromobacteriaceae: N E > Chromobacterium group: N E > Chromobacterium: N E > Chromobacterium sp. USM2: N E


Molecular evidence
Database
No mutation
2 structures: 5XAV, 6K3C
No kinetic





No Substrate
No inhibitor
1 Genbank : ADL70203
1 UniProt : E1APK1
2 Structure : 5XAV, 6K3C
1 UniProt : E1APK1
1 Interpro : E1APK1
1 Prodom : E1APK1
1 Pfam : E1APK1
1 PIRSF : E1APK1
1 SUPERFAM : E1APK1
Sequence
Graphical view for this peptide sequence: 9neis-e1apk1
Colored MSA for PHA_synth_I (raw)
MQQFVNSLSLGQDQSDAPHPLTGAWSQLMSQTNQLLQLQSSLYQQQLGLW
TQFLGQTAGNDASAPSAKPSDRRFASPEWDEHPFYSFLKQSYLQTSKWMM
ELVDKTQIDESAKDKLSFATRQYLDAMAPSNFMLTNPDVVKRAIETQGES
LVEGMKNMMEDIQKGHISMSDESKFQIGKNLVVTPGEVVFRNELIELIQY
TPTTEKVHEKPLLFVPPCINKYYLMDLQPDNSMVRHFVGQGYRVFLVSWR
SAVPEMKNFTWETYIEKGVFAAAEAVQKITKQPTMNALGFCVGGVILTTA
LCVAQAKGLKYFDSATFMTSLIDHAEPGEISFFIDEALVASREAKMAAGG
IISGKEIGRTFASLRANDLVWNYVVNNYLLGKTPAPFDLLYWNNDAVDLP
LPMHTFMLRQFYINNALITPGAITLCGVPIDISKIDIPVYMFAAREDHIV
LWSSAYSGLKYLSGTPSRRFVLGASGHIAGSINPVTKDKRNYWTNEQLPV
NPEEWLEGAQSHPGSWWKDWDAWLAPQSGKQVPAPKMLGSKEFPPLQPAP
GSYVLAKAMPPVAAALN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQQFVNSLSLGQDQSDAPHPLTGAWSQLMSQTNQLLQLQSSLYQQQLGLW
TQFLGQTAGNDASAPSAKPSDRRFASPEWDEHPFYSFLKQSYLQTSKWMM
ELVDKTQIDESAKDKLSFATRQYLDAMAPSNFMLTNPDVVKRAIETQGES
LVEGMKNMMEDIQKGHISMSDESKFQIGKNLVVTPGEVVFRNELIELIQY
TPTTEKVHEKPLLFVPPCINKYYLMDLQPDNSMVRHFVGQGYRVFLVSWR
SAVPEMKNFTWETYIEKGVFAAAEAVQKITKQPTMNALGFCVGGVILTTA
LCVAQAKGLKYFDSATFMTSLIDHAEPGEISFFIDEALVASREAKMAAGG
IISGKEIGRTFASLRANDLVWNYVVNNYLLGKTPAPFDLLYWNNDAVDLP
LPMHTFMLRQFYINNALITPGAITLCGVPIDISKIDIPVYMFAAREDHIV
LWSSAYSGLKYLSGTPSRRFVLGASGHIAGSINPVTKDKRNYWTNEQLPV
NPEEWLEGAQSHPGSWWKDWDAWLAPQSGKQVPAPKMLGSKEFPPLQPAP
GSYVLAKAMPPVAAALN


References
1 more
    Title: Structure of polyhydroxyalkanoate (PHA) synthase PhaC from Chromobacterium sp. USM2, producing biodegradable plastics
    Chek MF, Kim SY, Mori T, Arsad H, Samian MR, Sudesh K, Hakoshima T
    Ref: Sci Rep, 7:5312, 2017 : PubMed

            

    Title: Revelation of the ability of Burkholderia sp. USM (JCM 15050) PHA synthase to polymerize 4-hydroxybutyrate monomer
    Lau NS, Sudesh K
    Ref: AMB Express, 2:41, 2012 : PubMed

            

    Title: Characterization of the highly active polyhydroxyalkanoate synthase of Chromobacterium sp. strain USM2
    Bhubalan K, Chuah JA, Shozui F, Brigham CJ, Taguchi S, Sinskey AJ, Rha C, Sudesh K
    Ref: Applied Environmental Microbiology, 77:2926, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer