Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9pass-a0a093qu66

Manacus vitellinus (golden-collared manakin); Lonchura striata domestica (Bengalese finch); Corvus brachyrhynchos (American crow); Taeniopygia guttata (Zebra finch) (Poephila guttata). Protein FAM172A

Comment
Other strains: Manacus vitellinus (golden-collared manakin); Lonchura striata domestica (Bengalese finch); Corvus brachyrhynchos (American crow); Taeniopygia guttata (Zebra finch) (Poephila guttata)


Relationship
Family|Arb2_FAM172A
Block| X
Position in NCBI Life Tree|Manacus vitellinus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Sauropsida: N E > Sauria: N E > Archelosauria: N E > Archosauria: N E > Dinosauria: N E > Saurischia: N E > Theropoda: N E > Coelurosauria: N E > Aves: N E > Neognathae: N E > Passeriformes: N E > Pipridae: N E > Manacus: N E > Manacus vitellinus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: 9pass-a0a093qu66
Colored MSA for Arb2_FAM172A (raw)
IYFSILNLLTFWVVMAQLQQGGPDEKEKTTALKDLLSRIDLDELMKKDEP
PLEFPDTLEGFEYIFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEALG
EIITKYVYELLQKECHLKKVTLPVDATESEPKSFIFMSEDALINPDKLLV
LIHGNGVVRAGQWARRLIINEDLDSGTQIPYIKRAIGEGYGVIVLNPNEN
YIEVEKTKAQIQLSSDCSDEPAEKRERKDKIQKETKKRRDFYEKYRNPQK
EKETMQIYIRDNGSPEEHAIYVWDHFISQSAAENVFFVAHSYGGLAFVEL
MIQREAEVKNKVTAVALTDSVHNVWHQEVGKTIREWMRENCCNWVSSSEP
LDTSVESMLPDCPRVSAGTERHELTSWKSFPSVFKFFSEAVKAKNSLVKP
TPMRRSNRIKYEE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

IYFSILNLLTFWVVMAQLQQGGPDEKEKTTALKDLLSRIDLDELMKKDEP
PLEFPDTLEGFEYIFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEALG
EIITKYVYELLQKECHLKKVTLPVDATESEPKSFIFMSEDALINPDKLLV
LIHGNGVVRAGQWARRLIINEDLDSGTQIPYIKRAIGEGYGVIVLNPNEN
YIEVEKTKAQIQLSSDCSDEPAEKRERKDKIQKETKKRRDFYEKYRNPQK
EKETMQIYIRDNGSPEEHAIYVWDHFISQSAAENVFFVAHSYGGLAFVEL
MIQREAEVKNKVTAVALTDSVHNVWHQEVGKTIREWMRENCCNWVSSSEP
LDTSVESMLPDCPRVSAGTERHELTSWKSFPSVFKFFSEAVKAKNSLVKP
TPMRRSNRIKYEE


Reference
    Title: The genome of a songbird
    Warren WC, Clayton DF, Ellegren H, Arnold AP, Hillier LW, Kunstner A, Searle S, White S, Vilella AJ and Wilson RK <72 more author(s)>
    Ref: Nature, 464:757, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer