Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9psed-q0mrg5

Pseudomonas veronii Homoserine O-acetyltransferase like esterase MekB

Relationship
Family|Homoserine_transacetylase_like_est
Block| X
Position in NCBI Life Tree|Pseudomonas veronii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas fluorescens group: N E > Pseudomonas veronii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 5E4Y, 5EFZ
No kinetic





3 substrates: Ethylacetate, Paranitrophenylacetate, Vinyl-acetate
No inhibitor
1 Genbank : ABI15712
1 UniProt : Q0MRG5
2 Structure : 5EFZ, 5E4Y
1 UniProt : Q0MRG5
1 Interpro : Q0MRG5
1 Prodom : Q0MRG5
1 Pfam : Q0MRG5
1 PIRSF : Q0MRG5
1 SUPERFAM : Q0MRG5
Sequence
Graphical view for this peptide sequence: 9psed-q0mrg5
Colored MSA for Homoserine_transacetylase_like_est (raw)
MNSYYTEENHGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAI
LVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGG
SLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAV
RYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAV
AAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMD
PNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDD
CLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSSPAY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNSYYTEENHGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAI
LVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGG
SLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAV
RYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAV
AAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMD
PNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDD
CLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSSPAY


References
    Title: Rapid identification of unknown carboxyl esterase activity in Corynebacterium glutamicum using RNA-guided CRISPR interference
    Lee SS, Shin H, Jo S, Lee SM, Um Y, Woo HM
    Ref: Enzyme Microb Technol, 114:63, 2018 : PubMed

            

    Title: A novel esterase subfamily with alpha/beta-hydrolase fold suggested by structures of two bacterial enzymes homologous to l-homoserine O-acetyl transferases
    Tolzer C, Pal S, Watzlawick H, Altenbuchner J, Niefind K
    Ref: FEBS Letters, 590:174, 2016 : PubMed

            

    Title: Degradation of alkyl methyl ketones by Pseudomonas veronii MEK700
    Onaca C, Kieninger M, Engesser KH, Altenbuchner J
    Ref: Journal of Bacteriology, 189:3759, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer