Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9rosa-CXE1

Malus pumila (Paradise apple); Malus domestica (Apple) (Pyrus malus) CXE1 carboxylesterase MdCXE1 (EC 3.1.1.1)

Comment
Other strains: Malus pumila (Paradise apple); Malus domestica (Apple) (Pyrus malus) Marshall S.D.G., Oakeshott J.G., Russell R.J., Plummer K.M., Newcomb R.D MdCXE1 is expressed at low levels during early stages of fruit development, rising to a peak of expression in apple fruit at harvest maturity. MdCXE1 hydrolyse 4-methyl umbelliferyl ester substrates that included those containing acyl moieties that are found in esters produced by apple fruit. MdCXE1 is inhibited by organophosphates. MdCXE1 showed increasing affinity (Km) but decreasing turnover (kcat) as substrate acyl carbon length increases from C2 to C16. MdCXE1 may have an impact on apple flavour through its ability to hydrolyse relevant flavour esters in ripe apple fruit.


Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Malus pumila
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Rosales: N E > Rosaceae: N E > Maloideae: N E > Maleae: N E > Malus: N E > Malus pumila: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: ES789959, DQ279902, ABB89001
2 UniProt : Q0ZPW9, A0A498J3C4
2 UniProt : A0A498J3C4, Q0ZPW9
2 Interpro : A0A498J3C4, Q0ZPW9
2 Prodom : A0A498J3C4, Q0ZPW9
2 Pfam : A0A498J3C4, Q0ZPW9
2 PIRSF : A0A498J3C4, Q0ZPW9
2 SUPERFAM : A0A498J3C4, Q0ZPW9
Sequence
Graphical view for this peptide sequence: 9rosa-CXE1
Colored MSA for Plant_carboxylesterase (raw)
MTTSLDSSTQKTAPSWTSLPWRTRVSLSVLSKITDAARRADGTVNRRLMN
ILDFKSSATPAAPVRGVTSSDVTVDPARKLWFRLFVPQSTLSTPSDLPVI
VFFHGGGFTFLSPASFAYNAVCRKFARKFPAVVVSVNYRLCPEHRYPSPY
DDGFDVLTFLDQNDDVLPKNADRSRIFLAGDSAGANVAHHVAVRAAREKD
RMRVVKPVGLISIQPFFGGEERVESEIRLRGAPLVSVGRTDWLWKVFLPD
GSNRDHEAANVSGPNAVDISGLEYPNTIVFTGGLDPLLDRQRRYYQWLKK
SGKEAKLIEYPNMVHAFYVFPELPESNQLINQVKDFIASV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTTSLDSSTQKTAPSWTSLPWRTRVSLSVLSKITDAARRADGTVNRRLMN
ILDFKSSATPAAPVRGVTSSDVTVDPARKLWFRLFVPQSTLSTPSDLPVI
VFFHGGGFTFLSPASFAYNAVCRKFARKFPAVVVSVNYRLCPEHRYPSPY
DDGFDVLTFLDQNDDVLPKNADRSRIFLAGDSAGANVAHHVAVRAAREKD
RMRVVKPVGLISIQPFFGGEERVESEIRLRGAPLVSVGRTDWLWKVFLPD
GSNRDHEAANVSGPNAVDISGLEYPNTIVFTGGLDPLLDRQRRYYQWLKK
SGKEAKLIEYPNMVHAFYVFPELPESNQLINQVKDFIASV


References
    Title: Biochemical characterisation of MdCXE1, a carboxylesterase from apple that is expressed during fruit ripening
    Souleyre EJ, Marshall SD, Oakeshott JG, Russell RJ, Plummer KM, Newcomb RD
    Ref: Phytochemistry, 72:564, 2011 : PubMed

            

    Title: The carboxylesterase gene family from Arabidopsis thaliana
    Marshall SD, Putterill JJ, Plummer KM, Newcomb RD
    Ref: Journal of Molecular Evolution, 57:487, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer