Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9rosa-CXE8

Malus pumila CXE8 carboxylesterase (EC 3.1.1.1)

Comment
Marshall S.D.G., Oakeshott J.G., Russell R.J., Plummer K.M., Newcomb R.D


Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Malus pumila
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Rosales: N E > Rosaceae: N E > Maloideae: N E > Maleae: N E > Malus: N E > Malus pumila: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : DQ279909
1 UniProt : Q0ZPW2
1 UniProt : Q0ZPW2
1 Interpro : Q0ZPW2
1 Prodom : Q0ZPW2
1 Pfam : Q0ZPW2
1 PIRSF : Q0ZPW2
1 SUPERFAM : Q0ZPW2
Sequence
Graphical view for this peptide sequence: 9rosa-CXE8
Colored MSA for Plant_carboxylesterase (raw)
MATIAKELAFKSYPFIRIFEDGTVERIPFPYSSYVPPSPDQDPETGVYSK
DITISDNPKFSARLFLPNLPQNQTQKLSILVYFHGGAFCMASTFSFLHQR
YLNRLVSEAKVVAVSVEYRLAPENPLPIAYEDCWAALQWVASHSINKGSS
DGNKETWLLNYGYFDRVYIGGDSAGGNIAHNLVMKAGVEGLCGGVKILGV
FLSCPYFWGSKPIGSEPKGENFEKTLPYLVWDFVYPSAPGGIDNPMVNPA
GEGAPSLTGLGCSKLLVCVAGKDHLRDRGVQYYDLVKESGWKGELELFEV
EGEDHCFHVSLGIETKTDQTETTTENVKKMFKRLASFLV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MATIAKELAFKSYPFIRIFEDGTVERIPFPYSSYVPPSPDQDPETGVYSK
DITISDNPKFSARLFLPNLPQNQTQKLSILVYFHGGAFCMASTFSFLHQR
YLNRLVSEAKVVAVSVEYRLAPENPLPIAYEDCWAALQWVASHSINKGSS
DGNKETWLLNYGYFDRVYIGGDSAGGNIAHNLVMKAGVEGLCGGVKILGV
FLSCPYFWGSKPIGSEPKGENFEKTLPYLVWDFVYPSAPGGIDNPMVNPA
GEGAPSLTGLGCSKLLVCVAGKDHLRDRGVQYYDLVKESGWKGELELFEV
EGEDHCFHVSLGIETKTDQTETTTENVKKMFKRLASFLV


References
    Title: Biochemical characterisation of MdCXE1, a carboxylesterase from apple that is expressed during fruit ripening
    Souleyre EJ, Marshall SD, Oakeshott JG, Russell RJ, Plummer KM, Newcomb RD
    Ref: Phytochemistry, 72:564, 2011 : PubMed

            

    Title: The carboxylesterase gene family from Arabidopsis thaliana
    Marshall SD, Putterill JJ, Plummer KM, Newcomb RD
    Ref: Journal of Molecular Evolution, 57:487, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer