Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: acrec-f4wlq1

Acromyrmex echinatior (Panamanian leafcutter ant) (Acromyrmex octospinosus echinatior). Uncharacterized protein ABHD18 C4orf29-like protein

Relationship
Family|ABHD18
Block| X
Position in NCBI Life Tree|Acromyrmex echinatior
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Hymenoptera: N E > Apocrita: N E > Aculeata: N E > Vespoidea: N E > Formicidae: N E > Myrmicinae: N E > Attini: N E > Acromyrmex: N E > Acromyrmex echinatior: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : GL888212
1 UniProt : F4WLQ1
1 UniProt : F4WLQ1
1 Interpro : F4WLQ1
1 Pfam : F4WLQ1
1 PIRSF : F4WLQ1
1 SUPERFAM : F4WLQ1
Sequence
Graphical view for this peptide sequence: acrec-f4wlq1
Colored MSA for ABHD18 (raw)
MPPSRLDAVYRSILLTKFFTKGWGNPQNLRRIFEFRKVIANRKTCYNMIP
INYPIEITKDEVWSDCHIIEGRFESPFEKHLPGIMPDKTKMAYFQMVLPS
KWNSHKIKPICLHLAGTGDHFFWRRRNLIAKPLLKESGIASILLENPFYG
LRKPDDQKRSSLHNVCDIFIMGGCLIMESIVLLNWCEQHGFGPLALTGLS
MGGHMASLAATNWPKPISLVPCLSWSTASPVFTEGVMSASINWALLETQY
FSDEAYQNDLAKMVKVIDHDDAFLAGQHFAKHFPASMKRVNKLRKEFNES
NEDNNTISDAISTNSIDNRNEINVSIESKNDSNQLQYQIAEEKAAAKIFP
LNLISNRFKSKNPNTLKGVCLLPVPKHPLFSDNKWREHEALQFMRGIMDE
CTHLKNFEIPVDTELIIAVCAKNDAYVPRDHCMSLETIWPGAEIRYIDAG
HVSAYLLHQKVFRSTIAECIQRSMKKYPTEVS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPPSRLDAVYRSILLTKFFTKGWGNPQNLRRIFEFRKVIANRKTCYNMIP
INYPIEITKDEVWSDCHIIEGRFESPFEKHLPGIMPDKTKMAYFQMVLPS
KWNSHKIKPICLHLAGTGDHFFWRRRNLIAKPLLKESGIASILLENPFYG
LRKPDDQKRSSLHNVCDIFIMGGCLIMESIVLLNWCEQHGFGPLALTGLS
MGGHMASLAATNWPKPISLVPCLSWSTASPVFTEGVMSASINWALLETQY
FSDEAYQNDLAKMVKVIDHDDAFLAGQHFAKHFPASMKRVNKLRKEFNES
NEDNNTISDAISTNSIDNRNEINVSIESKNDSNQLQYQIAEEKAAAKIFP
LNLISNRFKSKNPNTLKGVCLLPVPKHPLFSDNKWREHEALQFMRGIMDE
CTHLKNFEIPVDTELIIAVCAKNDAYVPRDHCMSLETIWPGAEIRYIDAG
HVSAYLLHQKVFRSTIAECIQRSMKKYPTEVS


Reference
    Title: The genome of the leaf-cutting ant Acromyrmex echinatior suggests key adaptations to advanced social life and fungus farming
    Nygaard S, Zhang G, Schiott M, Li C, Wurm Y, Hu H, Zhou J, Ji L, Qiu F and Boomsma JJ <6 more author(s)>
    Ref: Genome Res, 21:1339, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer