Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: actde-CXE4

Actinidia deliciosa (Kiwi) CXE4 carboxylesterase (EC 3.1.1.1)

Comment
Marshall S.D.G., Oakeshott J.G., Russell R.J., Plummer K.M., Newcomb R.D


Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Actinidia deliciosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > Ericales: N E > Actinidiaceae: N E > Actinidia: N E > Actinidia deliciosa: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : DQ279917
1 UniProt : Q0ZPV4
1 UniProt : Q0ZPV4
1 Interpro : Q0ZPV4
1 Prodom : Q0ZPV4
1 Pfam : Q0ZPV4
1 PIRSF : Q0ZPV4
1 SUPERFAM : Q0ZPV4
Sequence
Graphical view for this peptide sequence: actde-CXE4
Colored MSA for Plant_carboxylesterase (raw)
MATITTNTSQQPYEVDECRGVLRVYSDGSIVRSPKPSFNVPVHDDGSVLW
KDVTFDATHNLQLRLYKPASATESLPIFYYIHGGGFCIGSRAWPNCQNYC
FRLALALRAIVVSPDYRLAPENRLPAAIEDGYAAVKWLRDQAEAAEPDPW
LAGVADFSRVFISGDSAGGNIAHNLAVGLGAGSAELGPMVRVRGYVLLAP
FFGGTVLTRSESEGPKEAFLNWELIDRFWRLSIPVGETTDHLLVNPFGPV
SRPLESLDLDPILVVVGGSDLLKDRAEDYANKLKGWGKKVQYVEFEGQHH
GFFTIDPNSQPSNDLMRIIKQFIAEN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MATITTNTSQQPYEVDECRGVLRVYSDGSIVRSPKPSFNVPVHDDGSVLW
KDVTFDATHNLQLRLYKPASATESLPIFYYIHGGGFCIGSRAWPNCQNYC
FRLALALRAIVVSPDYRLAPENRLPAAIEDGYAAVKWLRDQAEAAEPDPW
LAGVADFSRVFISGDSAGGNIAHNLAVGLGAGSAELGPMVRVRGYVLLAP
FFGGTVLTRSESEGPKEAFLNWELIDRFWRLSIPVGETTDHLLVNPFGPV
SRPLESLDLDPILVVVGGSDLLKDRAEDYANKLKGWGKKVQYVEFEGQHH
GFFTIDPNSQPSNDLMRIIKQFIAEN


Reference
    Title: The carboxylesterase gene family from Arabidopsis thaliana
    Marshall SD, Putterill JJ, Plummer KM, Newcomb RD
    Ref: Journal of Molecular Evolution, 57:487, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer