Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: agrsh-f0lfg1

Agrobacterium sp. (strain H13-3) (Rhizobium lupini (strain H13-3)) Putative uncharacterized protein

Relationship
Family|PolyAspartate-hydrolase
Block| X
Position in NCBI Life Tree|Agrobacterium sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Rhizobiaceae: N E > Rhizobium/Agrobacterium group: N E > Agrobacterium: N E > Agrobacterium sp.: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP002250
1 UniProt : F0LFG1
1 UniProt : F0LFG1
1 Interpro : F0LFG1
1 Pfam : F0LFG1
1 PIRSF : F0LFG1
1 SUPERFAM : F0LFG1
Sequence
Graphical view for this peptide sequence: agrsh-f0lfg1
Colored MSA for PolyAspartate-hydrolase (raw)
MSVTQKAVPLNFYRRGRTPIFASRMDQRFSWCCYIPEGYDPAGEIVHPLA
VLVHGSLRDADILRDEFIDFAEQHQCVLLAPLFPAGIDDPDDLHNYKHMI
YHGIRYDLVLLDMIDELATRYRVEKDKVLMHGFSGGAQFAHRFLYLHPHR
LRAVSVGAPGTVTLPDDRAKWWVGLNGMEEIFGQPIGIDAMRRVAVQLVI
GDADIETWDVTVGPKSPFWMEGINDSGETRVERLRTLEKGLKAIGVEPRF
DTVAGISHDGTGIQPPVKAFFSAVLKD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSVTQKAVPLNFYRRGRTPIFASRMDQRFSWCCYIPEGYDPAGEIVHPLA
VLVHGSLRDADILRDEFIDFAEQHQCVLLAPLFPAGIDDPDDLHNYKHMI
YHGIRYDLVLLDMIDELATRYRVEKDKVLMHGFSGGAQFAHRFLYLHPHR
LRAVSVGAPGTVTLPDDRAKWWVGLNGMEEIFGQPIGIDAMRRVAVQLVI
GDADIETWDVTVGPKSPFWMEGINDSGETRVERLRTLEKGLKAIGVEPRF
DTVAGISHDGTGIQPPVKAFFSAVLKD


Reference
    Title: Complete genome sequencing of Agrobacterium sp. H13-3, the former Rhizobium lupini H13-3, reveals a tripartite genome consisting of a circular and a linear chromosome and an accessory plasmid but lacking a tumor-inducing Ti-plasmid
    Wibberg D, Blom J, Jaenicke S, Kollin F, Rupp O, Scharf B, Schneiker-Bekel S, Sczcepanowski R, Goesmann A and Schluter A <3 more author(s)>
    Ref: J Biotechnol, 155:50, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer