Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: apime-vdpp4

Apis mellifera (Honeybee) Venom dipeptidyl peptidase IV

Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Apis mellifera
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Hymenoptera: N E > Apocrita: N E > Aculeata: N E > Apoidea: N E > Apidae: N E > Apinae: N E > Apini: N E > Apis: N E > Apis mellifera: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : EU564832
1 UniProt : B2D0J4
1 UniProt : B2D0J4
1 Interpro : B2D0J4
1 Pfam : B2D0J4
1 PIRSF : B2D0J4
1 SUPERFAM : B2D0J4
Sequence
Graphical view for this peptide sequence: apime-vdpp4
Colored MSA for DPP4N_Peptidase_S9 (raw)
MEVLVQLALLLVVHGSLVVLVAGKSVPRVIDQDLERYEPLEEEDHRGARV
PFNLEETYDQSFRANSFNGTWKTDREILYSDNYVGDIRLFDVTTGSGTVL
LDSSVTADFDKASVMFSFDNSHVAIGHDYVNGFRYSIHQKCTVYNIKSRT
FTDIANGDRIPLFKWSPTRNALIYVHKNDIYYQVFFEGGSDTRRITNTGV
PDIVFNGIPDWVYEEEVLGSPVAFWISPDGRHLAFATFNDTNVRDIVISK
YGSPGNSRDQYPNEIRIKYPKAGTTNPFVSLSVIDLHDPSSKLIDLPPPV
DVVGADNVLYTANWRRDGEIVATWTNRVQNKAQLVLYDTKGNANNIYYEE
ETEGWLRIQPPLYHDRYVIVAKLQDSGTKAGRFLHATRLEYRNGALVDET
DLTPGTCEVISLLLVDHARARLYYLGTELGKPSHKNLYSVQLSGNEPPVC
LSCDVLTPEGNRCTYAYAYFSTNGSHYALYCAGPDPVFIAIVNANHRQIS
IWEENRSLRRKLAARTQPIVKNFNVNANGYTNKVKLYLPPDFDETKKYPL
LITVYAGPNTIRITEEATYGFESYIVTNRSVIYGRIDGRGSAYKGSKMLF
EIYRRLGTVEIEDQIIITRTLQEKYSWIDSNRTGIWGWSYGGFSAAMVLA
TDAESVFKCGISVAPVTSWIYYDSLYTERFMGLPTPEDNQSGYNDTDVSR
RVEGMRGKKYMLIHGTADDNVHYQQTMMLNKALVNSDIMFQQQTYTDEAH
ALGNVFPHLYHTTDRFWANCLGYSH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEVLVQLALLLVVHGSLVVLVAGKSVPRVIDQDLERYEPLEEEDHRGARV
PFNLEETYDQSFRANSFNGTWKTDREILYSDNYVGDIRLFDVTTGSGTVL
LDSSVTADFDKASVMFSFDNSHVAIGHDYVNGFRYSIHQKCTVYNIKSRT
FTDIANGDRIPLFKWSPTRNALIYVHKNDIYYQVFFEGGSDTRRITNTGV
PDIVFNGIPDWVYEEEVLGSPVAFWISPDGRHLAFATFNDTNVRDIVISK
YGSPGNSRDQYPNEIRIKYPKAGTTNPFVSLSVIDLHDPSSKLIDLPPPV
DVVGADNVLYTANWRRDGEIVATWTNRVQNKAQLVLYDTKGNANNIYYEE
ETEGWLRIQPPLYHDRYVIVAKLQDSGTKAGRFLHATRLEYRNGALVDET
DLTPGTCEVISLLLVDHARARLYYLGTELGKPSHKNLYSVQLSGNEPPVC
LSCDVLTPEGNRCTYAYAYFSTNGSHYALYCAGPDPVFIAIVNANHRQIS
IWEENRSLRRKLAARTQPIVKNFNVNANGYTNKVKLYLPPDFDETKKYPL
LITVYAGPNTIRITEEATYGFESYIVTNRSVIYGRIDGRGSAYKGSKMLF
EIYRRLGTVEIEDQIIITRTLQEKYSWIDSNRTGIWGWSYGGFSAAMVLA
TDAESVFKCGISVAPVTSWIYYDSLYTERFMGLPTPEDNQSGYNDTDVSR
RVEGMRGKKYMLIHGTADDNVHYQQTMMLNKALVNSDIMFQQQTYTDEAH
ALGNVFPHLYHTTDRFWANCLGYSH


References
    Title: Identification, recombinant expression, and characterization of the 100 kDa high molecular weight Hymenoptera venom allergens Api m 5 and Ves v 3
    Blank S, Seismann H, Bockisch B, Braren I, Cifuentes L, McIntyre M, Ruhl D, Ring J, Bredehorst R and Spillner E <2 more author(s)>
    Ref: J Immunol, 184:5403, 2010 : PubMed

            

    Title: Insights into social insects from the genome of the honeybee Apis mellifera
    Weinstock GM, Consortium HGS
    Ref: Nature, 443:931, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer