Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-F14J22.11

Arabidopsis thaliana (Mouse-ear cress) AtCXE5 AT1G49660 f14j22.11 protein

Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AC011807
1 UniProt : Q9FX94
1 Interpro : Q9FX94
1 Prodom : Q9FX94
1 Pfam : Q9FX94
1 PIRSF : Q9FX94
1 SUPERFAM : Q9FX94
1 Tair database : AT1G49660
Sequence
Graphical view for this peptide sequence: arath-F14J22.11
Colored MSA for Plant_carboxylesterase (raw)
MESEIASEFLPFCRIYKDGRVERLIGTDTIPASLDPTYDVVSKDVIYSPE
NNLSVRLFLPHKSTKLTAGNKLPLLIYIHGGAWIIESPFSPLYHNYLTEV
VKSANCLAVSVQYRRAPEDPVPAAYEDVWSAIQWIFAHSNGSGPVDWINK
HADFGKVFLGGDSAGGNISHHMAMKAGKEKKLDLKIKGIAVVHPAFWGTD
PVDEYDVQDKETRSGIAEIWEKIASPNSVNGTDDPLFNVNGSGSDFSGLG
CDKVLVAVAGKDVFVRQGLAYAAKLEKCEWEGTVEVVEEEGEDHVFHLQN
PKSDKALKFLKKFVEFIIG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MESEIASEFLPFCRIYKDGRVERLIGTDTIPASLDPTYDVVSKDVIYSPE
NNLSVRLFLPHKSTKLTAGNKLPLLIYIHGGAWIIESPFSPLYHNYLTEV
VKSANCLAVSVQYRRAPEDPVPAAYEDVWSAIQWIFAHSNGSGPVDWINK
HADFGKVFLGGDSAGGNISHHMAMKAGKEKKLDLKIKGIAVVHPAFWGTD
PVDEYDVQDKETRSGIAEIWEKIASPNSVNGTDDPLFNVNGSGSDFSGLG
CDKVLVAVAGKDVFVRQGLAYAAKLEKCEWEGTVEVVEEEGEDHVFHLQN
PKSDKALKFLKKFVEFIIG


Reference
    Title: The carboxylesterase gene family from Arabidopsis thaliana
    Marshall SD, Putterill JJ, Plummer KM, Newcomb RD
    Ref: Journal of Molecular Evolution, 57:487, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer