Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: baca2-a7z7y5

Bacillus amyloliquefaciens, Bacillus atrophaeus, Phospholipase component of bacilysocin synthesis or export YtpA

Comment
Other strains: Bacillus amyloliquefaciens (strain FZB42; ATCC 23350 / DSM 7 / BCRC 11601 / NBRC 15535 / NRRL B-14393)Bacillus atrophaeus (strain 1942)


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Bacillus amyloliquefaciens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus amyloliquefaciens group: N E > Bacillus amyloliquefaciens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CP000560, FN597644, CP002207
1 UniProt : A7Z7Y5
1 UniProt : A7Z7Y5
1 Interpro : A7Z7Y5
1 Prodom : A7Z7Y5
1 Pfam : A7Z7Y5
1 PIRSF : A7Z7Y5
1 SUPERFAM : A7Z7Y5
Sequence
Graphical view for this peptide sequence: baca2-a7z7y5
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MWTWKADRPVGTIVIIHGASEYHGRYKWLVEMWRSSGYNVVMGDLPGQGT
STRARGHIRSFQEYIDEVDIWIDKARTLEAPVFLLGHSMGGLIAIEWFKQ
QRNPRITALILSSPCLGLQIKVNKVLDFASKGLNVLAPSLRVDSGLSPDM
ATRNADMIEADQNDSLYVTKVSVRWYRELLKTIDAAMVPTDAFLKVPLLL
MQGGDDKIVDKMKVRKWFSGVASHNKSYREWEGLYHEIFNEPERETVFKA
AKAFTDQYI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWTWKADRPVGTIVIIHGASEYHGRYKWLVEMWRSSGYNVVMGDLPGQGT
STRARGHIRSFQEYIDEVDIWIDKARTLEAPVFLLGHSMGGLIAIEWFKQ
QRNPRITALILSSPCLGLQIKVNKVLDFASKGLNVLAPSLRVDSGLSPDM
ATRNADMIEADQNDSLYVTKVSVRWYRELLKTIDAAMVPTDAFLKVPLLL
MQGGDDKIVDKMKVRKWFSGVASHNKSYREWEGLYHEIFNEPERETVFKA
AKAFTDQYI


References
    Title: Genome sequence of B. amyloliquefaciens type strain DSM7(T) reveals differences to plant-associated B. amyloliquefaciens FZB42
    Ruckert C, Blom J, Chen X, Reva O, Borriss R
    Ref: J Biotechnol, 155:78, 2011 : PubMed

            

    Title: Comparative analysis of the complete genome sequence of the plant growth-promoting bacterium Bacillus amyloliquefaciens FZB42
    Chen XH, Koumoutsi A, Scholz R, Eisenreich A, Schneider K, Heinemeyer I, Morgenstern B, Voss B, Hess WR and Borriss R <9 more author(s)>
    Ref: Nat Biotechnol, 25:1007, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer