Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacam-q70jx5

Bacillus amyloliquefaciens (Bacillus velezensis); Streptococcus pneumoniae; Bacillus sp.; Bacillus subtilis, fene protein

Comment
Other strains: Bacillus amyloliquefaciens (Bacillus velezensis), Bacillus amyloliquefaciens (strains ATCC 23350 / DSM 7 / BCRC 11601 / NBRC 15535 / NRRL B-14393; FZB42; DSM 23117 / BGSC 10A6 / FZB42); Streptococcus pneumoniae; Bacillus sp.; Bacillus subtilis; Mycobacterium abscessus subsp.


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Bacillus amyloliquefaciens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus amyloliquefaciens group: N E > Bacillus amyloliquefaciens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: bacam-q70jx5
Colored MSA for Thioesterase (raw)
YYTGAHAEERAIQSLLARSLPDYMIPQYVMKLDRMPLTANGKVDRRGLPA
PERKKTSSKAVPPRNWVERELIDIWTPILGCGELGIQDDFFELGGHSLKA
LQVIHQLKTRQQMDVPIEMIFEYPTIEQLAEKLYSNTLSEAAEQHISRLN
QPKGRNLFCFPPISGFGIFFKDLAAALNGRAAVYGFNFIEEDSRMEQYID
KMLEIQPEGPYILFGYSAGGNTAFEAAKAMEKRGLEISDVIIADAYRKLD
ALPPQPTNATAENVPEAVREAVIKKTERYQTYWAELINDGQIAANLHFIE
AGIKEEHSDKTEPMKWEGATTGLYQEYQGGGAHKDMFEPAFAHQNAEVIL
DIIANSGRRLARNL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

YYTGAHAEERAIQSLLARSLPDYMIPQYVMKLDRMPLTANGKVDRRGLPA
PERKKTSSKAVPPRNWVERELIDIWTPILGCGELGIQDDFFELGGHSLKA
LQVIHQLKTRQQMDVPIEMIFEYPTIEQLAEKLYSNTLSEAAEQHISRLN
QPKGRNLFCFPPISGFGIFFKDLAAALNGRAAVYGFNFIEEDSRMEQYID
KMLEIQPEGPYILFGYSAGGNTAFEAAKAMEKRGLEISDVIIADAYRKLD
ALPPQPTNATAENVPEAVREAVIKKTERYQTYWAELINDGQIAANLHFIE
AGIKEEHSDKTEPMKWEGATTGLYQEYQGGGAHKDMFEPAFAHQNAEVIL
DIIANSGRRLARNL


References
    Title: Genome sequence of B. amyloliquefaciens type strain DSM7(T) reveals differences to plant-associated B. amyloliquefaciens FZB42
    Ruckert C, Blom J, Chen X, Reva O, Borriss R
    Ref: J Biotechnol, 155:78, 2011 : PubMed

            

    Title: Comparative analysis of the complete genome sequence of the plant growth-promoting bacterium Bacillus amyloliquefaciens FZB42
    Chen XH, Koumoutsi A, Scholz R, Eisenreich A, Schneider K, Heinemeyer I, Morgenstern B, Voss B, Hess WR and Borriss R <9 more author(s)>
    Ref: Nat Biotechnol, 25:1007, 2007 : PubMed

            

    Title: Structural and functional characterization of gene clusters directing nonribosomal synthesis of bioactive cyclic lipopeptides in Bacillus amyloliquefaciens strain FZB42
    Koumoutsi A, Chen XH, Henne A, Liesegang H, Hitzeroth G, Franke P, Vater J, Borriss R
    Ref: Journal of Bacteriology, 186:1084, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer