Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bovin-1lipg

Bos taurus (Bovine) Gastric triacylglycerol lipase

Relationship
Family|Acidic_Lipase
Block| X
Position in NCBI Life Tree|Bos taurus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Ruminantia: N E > Pecora: N E > Bovidae: N E > Bovinae: N E > Bos: N E > Bos taurus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : L26319, DAAA02058726
2 UniProt : Q29458, F1MES3
1 Ncbi-nid : 600756
1 Ncbi-pid : 600757
2 UniProt : Q29458, F1MES3
2 Interpro : Q29458, F1MES3
2 Prodom : Q29458, F1MES3
2 Pfam : Q29458, F1MES3
2 PIRSF : Q29458, F1MES3
2 SUPERFAM : Q29458, F1MES3
Sequence
Graphical view for this peptide sequence: bovin-1lipg
Colored MSA for Acidic_Lipase (raw)
MWWLLVTVCFIHMSGNAFCFLGKIAKNPEASMNVSQMISYWGYPSEMHKV
ITADGYILQVYRIPHGKNNANHLGQRPVVFLQHGLLGSATNWISNLPKNS
LGFLLADAGYDVWLGNSRGNTWAQEHLYYSPDSPEFWAFSFDEMAEYDLP
STIDFILRRTGQKKLHYVGHSQGTTIGFIAFSTSPTLAEKIKVFYALAPV
ATVKYTKSLFNKLALIPHFLFKIIFGDKMFYPHTFLEQFLGVEMCSRETL
DVLCKNALFAITGVDNKNFNMSRLDVYIAHNPAGTSVQNTLHWRQAVKSG
KFQAFDWGAPYQNLMHYHQPTPPIYNLTAMNVPIAVWSADNDLLADPQDV
DFLLSKLSNLIYHKEIPNYNHLDFIWAMDAPQEVYNEIVSLMAEDKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWWLLVTVCFIHMSGNAFCFLGKIAKNPEASMNVSQMISYWGYPSEMHKV
ITADGYILQVYRIPHGKNNANHLGQRPVVFLQHGLLGSATNWISNLPKNS
LGFLLADAGYDVWLGNSRGNTWAQEHLYYSPDSPEFWAFSFDEMAEYDLP
STIDFILRRTGQKKLHYVGHSQGTTIGFIAFSTSPTLAEKIKVFYALAPV
ATVKYTKSLFNKLALIPHFLFKIIFGDKMFYPHTFLEQFLGVEMCSRETL
DVLCKNALFAITGVDNKNFNMSRLDVYIAHNPAGTSVQNTLHWRQAVKSG
KFQAFDWGAPYQNLMHYHQPTPPIYNLTAMNVPIAVWSADNDLLADPQDV
DFLLSKLSNLIYHKEIPNYNHLDFIWAMDAPQEVYNEIVSLMAEDKK


References
    Title: A whole-genome assembly of the domestic cow, Bos taurus
    Zimin AV, Delcher AL, Florea L, Kelley DR, Schatz MC, Puiu D, Hanrahan F, Pertea G, Van Tassell CP and Salzberg SL <5 more author(s)>
    Ref: Genome Biol, 10:R42, 2009 : PubMed

            

    Title: The cDNA sequence encoding bovine pregastric esterase
    Timmermans MYJ, Kupers LP, Teuchy H
    Ref: Gene, 147:259, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer