Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: burxl-q13ul9

Burkholderia xenovorans; Burkholderia phytofirmans; Burkholderia graminis; Burkholderia sp.; Paraburkholderia dioscoreae S-Formylglutathione hydrolase (FghA)

Comment
Other strains: Burkholderia xenovorans (strain LB400) Burkholderia phytofirmans (strain DSM 17436 / PsJN) Burkholderia graminis C4D1M; Burkholderia sp. Ch1-1; Paraburkholderia dioscoreae


Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Burkholderia xenovorans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Paraburkholderia: N E > Paraburkholderia xenovorans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: ABLD01000009, EIF29807, WP_007180531
>3 UniProt links 2 more: Q13UL9, B2SYA8, B1G2B9
>3 UniProt links 1 more: Q13UL9, B2SYA8, B1G2B9
>3 Interpro links 1 more: Q13UL9, B2SYA8, B1G2B9
>3 Pfam links 1 more: Q13UL9, B2SYA8, B1G2B9
>3 PIRSF links 1 more: Q13UL9, B2SYA8, B1G2B9
>3 SUPERFAM links 1 more: Q13UL9, B2SYA8, B1G2B9
Sequence
Graphical view for this peptide sequence: burxl-q13ul9
Colored MSA for A85-EsteraseD-FGH (raw)
MAMLELLSSHACHGGEQRIYRHDSQTIGLPMRFSIYLPPQALQANANVPA
LFYLAGLTCTEETFPVKAGAQRFAAQHGIALIAPDTSPRGAGVPGESAAW
DFGVGAGFYVDATQQPWAQHYRMYSYVRDELRETVLANLPVDGARLGIFG
HSMGGHGALMLALRNPEIYRSVSAFAPIAAPTRCPWGEKAFSGYLGADRE
AWKQYDASELVAQASRKFAEGILVDQGLADQFLAEQLNPDVFEAACQAAG
QPLTLRRHAGYDHGYYFISTFIEDHLAHHAKVLLG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAMLELLSSHACHGGEQRIYRHDSQTIGLPMRFSIYLPPQALQANANVPA
LFYLAGLTCTEETFPVKAGAQRFAAQHGIALIAPDTSPRGAGVPGESAAW
DFGVGAGFYVDATQQPWAQHYRMYSYVRDELRETVLANLPVDGARLGIFG
HSMGGHGALMLALRNPEIYRSVSAFAPIAAPTRCPWGEKAFSGYLGADRE
AWKQYDASELVAQASRKFAEGILVDQGLADQFLAEQLNPDVFEAACQAAG
QPLTLRRHAGYDHGYYFISTFIEDHLAHHAKVLLG


Reference
    Title: Burkholderia xenovorans LB400 harbors a multi-replicon, 9.73-Mbp genome shaped for versatility
    Chain PS, Denef VJ, Konstantinidis KT, Vergez LM, Agullo L, Reyes VL, Hauser L, Cordova M, Gomez L and Tiedje JM <18 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 103:15280, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer