Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cajca-a0a151ryr0

Cajanus cajan (Pigeon pea) (Cajanus indicus). Dipeptidyl peptidase family member 6

Relationship
Family|Glutamyl_Peptidase_S9
Block| X
Position in NCBI Life Tree|Cajanus cajan
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Fabales: N E > Fabaceae: N E > Papilionoideae: N E > Phaseoleae: N E > Cajanus: N E > Cajanus cajan: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KQ483523
1 UniProt : A0A151RYR0
1 UniProt : A0A151RYR0
1 Interpro : A0A151RYR0
1 Pfam : A0A151RYR0
1 PIRSF : A0A151RYR0
1 SUPERFAM : A0A151RYR0
Sequence
Graphical view for this peptide sequence: cajca-a0a151ryr0
Colored MSA for Glutamyl_Peptidase_S9 (raw)
MMRLHKLYHRLTLLPFSPLSFPSNPSLLPLAPPLRLTLRRRTSPNFASMA
SSRFRNLAPLAAEDGAGSVTSSATAATSVDYDDESTTGGRYRVPPPEIRD
IVDAPPVPALSFSPLRDKILFLKRRALPPLAEIARPEEKLAGIRIDGKCN
TRSRMAFYTGIAIHQILADGTLGPEIEVHGFPDGAKINFVSWSPDGWHLS
FSIRVNEEDSDSSKLTVWIADVKTGKARPLFQSPNVHLNAVFDNYVWVNN
STLLVCTIPSSRGAPPKKPLVPGGPKIQANEEKNIIQVRTFQDLLKDEYD
EDLFDYYATSQLVLASLDGTKKEIGPPALYTSMDPSPDHKYILISSIHRP
YSFIVPCGRFPKKVQLWSADGKLIRELCDLPLAENIPIAFNSVRKGMRSI
NWRADKPSTLYWVETQDGGDAKVEISPRDIIYTQPAEPLEGEQPTILHKL
DLRYGGVSWCDDSLALVYESWYKTRKIRTWVVSPGSEDVAPRVLFDRSSE
DVYSDPGSPMMRRTQAGTYIIARIKKESDEGRYIILNGVGATEKGNIPFL
DLFDINTGIKERIWESDKEKYYETVVALMSDQVEGDLHLDKLKILTSKES
KTENTQYYFVSWPDKNIVQITNFPHPYPQLASLQKEMIRYQRKDGVQLTA
TLYLPPDYNPSTDGPLPCLVWSYPGEFKSKDAAGQVRGSPNEFAGIGSTS
ALLWLARRFAILSGPTIPIIGEGDEEANDRYVEQLVASAEAAVEEVIRRG
VADPMKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQ
NEDRTLWEATNTYVEMSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRF
FNALKGHGALCRLVILPHESHGYTARESIMHVLWETDRWLHKYCVSNSFC
AGEDHATGTVKEHVSKGTTNAESKVVATSGGGNKEASDLESEEFHSRPRS
SLW
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMRLHKLYHRLTLLPFSPLSFPSNPSLLPLAPPLRLTLRRRTSPNFASMA
SSRFRNLAPLAAEDGAGSVTSSATAATSVDYDDESTTGGRYRVPPPEIRD
IVDAPPVPALSFSPLRDKILFLKRRALPPLAEIARPEEKLAGIRIDGKCN
TRSRMAFYTGIAIHQILADGTLGPEIEVHGFPDGAKINFVSWSPDGWHLS
FSIRVNEEDSDSSKLTVWIADVKTGKARPLFQSPNVHLNAVFDNYVWVNN
STLLVCTIPSSRGAPPKKPLVPGGPKIQANEEKNIIQVRTFQDLLKDEYD
EDLFDYYATSQLVLASLDGTKKEIGPPALYTSMDPSPDHKYILISSIHRP
YSFIVPCGRFPKKVQLWSADGKLIRELCDLPLAENIPIAFNSVRKGMRSI
NWRADKPSTLYWVETQDGGDAKVEISPRDIIYTQPAEPLEGEQPTILHKL
DLRYGGVSWCDDSLALVYESWYKTRKIRTWVVSPGSEDVAPRVLFDRSSE
DVYSDPGSPMMRRTQAGTYIIARIKKESDEGRYIILNGVGATEKGNIPFL
DLFDINTGIKERIWESDKEKYYETVVALMSDQVEGDLHLDKLKILTSKES
KTENTQYYFVSWPDKNIVQITNFPHPYPQLASLQKEMIRYQRKDGVQLTA
TLYLPPDYNPSTDGPLPCLVWSYPGEFKSKDAAGQVRGSPNEFAGIGSTS
ALLWLARRFAILSGPTIPIIGEGDEEANDRYVEQLVASAEAAVEEVIRRG
VADPMKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQ
NEDRTLWEATNTYVEMSPFMSANKIKKPILLIHGEEDNNSGTLTMQSDRF
FNALKGHGALCRLVILPHESHGYTARESIMHVLWETDRWLHKYCVSNSFC
AGEDHATGTVKEHVSKGTTNAESKVVATSGGGNKEASDLESEEFHSRPRS
SLW


Reference
    Title: Draft genome sequence of pigeonpea (Cajanus cajan), an orphan legume crop of resource-poor farmers
    Varshney RK, Chen W, Li Y, Bharti AK, Saxena RK, Schlueter JA, Donoghue MT, Azam S, Fan G and Jackson SA <21 more author(s)>
    Ref: Nat Biotechnol, 30:83, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer