Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cordi-DIP1729

Corynebacterium diphtheriae putative drug resistance protein (hydrolase)

Comment
Other strains: Corynebacterium diphtheriae (strains 31A; 241; INCA 402; BH8; ATCC 27012 / C7 (beta); CDCE 8392; HC01; HC02; HC03; HC04; PW8; VA01; bv. intermedius str. NCTC 5011; Aberdeen; DSM 43988) doesnot seem to have the SEDCLYLN


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Corynebacterium diphtheriae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Corynebacteriaceae: N E > Corynebacterium: N E > Corynebacterium diphtheriae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: cordi-DIP1729
Colored MSA for Carb_B_Bacteria (raw)
MSEQITMGPYTGTIHGNAARFDAVAYATLPSEYSAAVRCFTPTQGDYHNN
YRTELHATITAPKAAHRYTDYPVIVYIHGGAYFEGSRDDISGLTFAEDKV
VVVSIDYRLGIQGFTPFAAEEPHHYRGIDDCTVALTWVQENIETFGGDPT
NVTVMGNSAGGGIALWLARRDHYTGLFRRLWVSSPAFPRGGDRRSATRWA
LSAPVTQTGLERLPRRKVVRAETSLRRRYFTDLAFGPHPFNAKELVTLPT
VVTYTTDECADFVGVKKLQASRWSKYIRKYLAKGLDALPKYIEQLPDDTY
FAQLTSDSMIRRWVERVAAARNPWVIEFAGEPALHCEDLPEIFGTGKVHD
IAVIFARGYDPLWQPYGQRRSVMSMRLDGSQDHIITDPLAHVRTGFMKS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSEQITMGPYTGTIHGNAARFDAVAYATLPSEYSAAVRCFTPTQGDYHNN
YRTELHATITAPKAAHRYTDYPVIVYIHGGAYFEGSRDDISGLTFAEDKV
VVVSIDYRLGIQGFTPFAAEEPHHYRGIDDCTVALTWVQENIETFGGDPT
NVTVMGNSAGGGIALWLARRDHYTGLFRRLWVSSPAFPRGGDRRSATRWA
LSAPVTQTGLERLPRRKVVRAETSLRRRYFTDLAFGPHPFNAKELVTLPT
VVTYTTDECADFVGVKKLQASRWSKYIRKYLAKGLDALPKYIEQLPDDTY
FAQLTSDSMIRRWVERVAAARNPWVIEFAGEPALHCEDLPEIFGTGKVHD
IAVIFARGYDPLWQPYGQRRSVMSMRLDGSQDHIITDPLAHVRTGFMKS


References
    Title: Draft genome sequence of Corynebacterium diphtheriae biovar intermedius NCTC 5011
    Sangal V, Tucker NP, Burkovski A, Hoskisson PA
    Ref: Journal of Bacteriology, 194:4738, 2012 : PubMed

            

    Title: The complete genome sequence and analysis of Corynebacterium diphtheriae NCTC13129
    Cerdeno-Tarraga AM, Efstratiou A, Dover LG, Holden MT, Pallen M, Bentley SD, Besra GS, Churcher C, James KD and Parkhill J <16 more author(s)>
    Ref: Nucleic Acids Research, 31:6516, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer