Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: crigr-a0a3l7ib08

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). SERHL

Relationship
Family|SERHL
Block| X
Position in NCBI Life Tree|Cricetulus griseus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Cricetidae: N E > Cricetinae: N E > Cricetulus: N E > Cricetulus griseus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: crigr-a0a3l7ib08
Colored MSA for SERHL (raw)
MFSELKLAVPWGHIAVKVWGSQKNPPVLCLHGWLDNANSFDRLIPLLPQD
FHYVAMDFGGHGLSSHYSPGLPYYHHNFVSEVRRVAAAFKWTRFSLLGHS
FGGTVGGMFACIFPEMVDQLILLDSTPFFLDSNETENILTYKRRNMEHMF
QVEASQNSLRVSSLEEMLQGLLNKNSHLNKECGELLLQRGTTKMATGVVL
NRDRRLSVPEHSFDFVSKEMFVHFIRRLQANVLLVKATQGYYDVRRANDE
NKEPLFFMVDTLRTILKERFQYVEIPGNHYVHMNNQHLVAGIVSAFLQSQ
PRTASRL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFSELKLAVPWGHIAVKVWGSQKNPPVLCLHGWLDNANSFDRLIPLLPQD
FHYVAMDFGGHGLSSHYSPGLPYYHHNFVSEVRRVAAAFKWTRFSLLGHS
FGGTVGGMFACIFPEMVDQLILLDSTPFFLDSNETENILTYKRRNMEHMF
QVEASQNSLRVSSLEEMLQGLLNKNSHLNKECGELLLQRGTTKMATGVVL
NRDRRLSVPEHSFDFVSKEMFVHFIRRLQANVLLVKATQGYYDVRRANDE
NKEPLFFMVDTLRTILKERFQYVEIPGNHYVHMNNQHLVAGIVSAFLQSQ
PRTASRL


References
    Title: A reference genome of the Chinese hamster based on a hybrid assembly strategy
    Rupp O, MacDonald ML, Li S, Dhiman H, Polson S, Griep S, Heffner K, Hernandez I, Brinkrolf K and Lee KH <8 more author(s)>
    Ref: Biotechnol Bioeng, 115:2087, 2018 : PubMed

            

    Title: The genomic sequence of the Chinese hamster ovary (CHO)-K1 cell line
    Xu X, Nagarajan H, Lewis NE, Pan S, Cai Z, Liu X, Chen W, Xie M, Wang W and Palsson BO <12 more author(s)>
    Ref: Nat Biotechnol, 29:735, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer