Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: danpl-a0a212fjb0

Danaus plexippus plexippus. Carboxylic ester hydrolase

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Danaus plexippus plexippus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Obtectomera: N E > Papilionoidea: N E > Nymphalidae: N E > Danainae: N E > Danaini: N E > Danaina: N E > Danaus [genus]: N E > Danaus [subgenus]: N E > Danaus plexippus: N E > Danaus plexippus plexippus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AGBW02008289
1 UniProt : A0A212FJB0
1 UniProt : A0A212FJB0
1 Interpro : A0A212FJB0
1 Pfam : A0A212FJB0
1 PIRSF : A0A212FJB0
1 SUPERFAM : A0A212FJB0
Sequence
Graphical view for this peptide sequence: danpl-a0a212fjb0
Colored MSA for ACHE (raw)
MRVLVAALAALLARVLASPHEHRARHHAPDHALHFSMPAPPQPYRGHGEA
VRYNPELDTILPRFDEQETSSKRAKYADTESSSKRANEERFYSNHERIEE
LMADEPQLGPEPDDPLIVRTTHGRVKGITLTAATGKKVDAWFGIPYAQKP
IGDLRFRHPRPIEKWGDEILNTTALPHSCVQIIDTVFGDFPGAMMWNPNT
DMQEDCLYINIVSPQPRPVNAPVMLWVFGGGFYSGTATLEVYDPKILVSE
ENIVYVTMQYRVASLGFLFFDTPDVPGNAGLFDQLMALQWVKDNIAYFGG
NPHNITLFGESAGAVSVSLHLLSPLSRNLFSQAIMQSGAATAPWAIISRE
ESILRGLRLAEAVHCPSSKTDTGPMINCLRKKSADELVNNEWGTLGICDF
PFVPIIDGSFLDEMPRKSLAHQNFKKTNVLMGSNTEEGYYFILYYLTELL
PKEENVGITREQYLQAVRELNPFVNDVSRQAIVYEYTDWLNPDDPVNNKN
SLDKMVGDYHFACGVNEFAHRYAETGNNVYTYYYKHRSKNSPWPSWTGVL
HGDEINYVFGEPLNPGKNYSPEEIEFSRRLMKYWANFAKTGNPSMDEKGE
TMKEYWPLYTTGGREYLSLEVNSSSVGHGLRLKQCVFWQKYLPQLMAATN
KPETPKNCTNTGFSRKPSHMMLSLSLFSLTVVKAINYI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRVLVAALAALLARVLASPHEHRARHHAPDHALHFSMPAPPQPYRGHGEA
VRYNPELDTILPRFDEQETSSKRAKYADTESSSKRANEERFYSNHERIEE
LMADEPQLGPEPDDPLIVRTTHGRVKGITLTAATGKKVDAWFGIPYAQKP
IGDLRFRHPRPIEKWGDEILNTTALPHSCVQIIDTVFGDFPGAMMWNPNT
DMQEDCLYINIVSPQPRPVNAPVMLWVFGGGFYSGTATLEVYDPKILVSE
ENIVYVTMQYRVASLGFLFFDTPDVPGNAGLFDQLMALQWVKDNIAYFGG
NPHNITLFGESAGAVSVSLHLLSPLSRNLFSQAIMQSGAATAPWAIISRE
ESILRGLRLAEAVHCPSSKTDTGPMINCLRKKSADELVNNEWGTLGICDF
PFVPIIDGSFLDEMPRKSLAHQNFKKTNVLMGSNTEEGYYFILYYLTELL
PKEENVGITREQYLQAVRELNPFVNDVSRQAIVYEYTDWLNPDDPVNNKN
SLDKMVGDYHFACGVNEFAHRYAETGNNVYTYYYKHRSKNSPWPSWTGVL
HGDEINYVFGEPLNPGKNYSPEEIEFSRRLMKYWANFAKTGNPSMDEKGE
TMKEYWPLYTTGGREYLSLEVNSSSVGHGLRLKQCVFWQKYLPQLMAATN
KPETPKNCTNTGFSRKPSHMMLSLSLFSLTVVKAINYI


Reference
    Title: The monarch butterfly genome yields insights into long-distance migration
    Zhan S, Merlin C, Boore JL, Reppert SM
    Ref: Cell, 147:1171, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer