Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: dinsh-a8lqy2

Dinoroseobacter shibae (strain DFL 12) Alpha/beta hydrolase fold protein

Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Dinoroseobacter shibae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhodobacterales: N E > Rhodobacteraceae: N E > Dinoroseobacter: N E > Dinoroseobacter shibae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000830
1 UniProt : A8LQY2
1 UniProt : A8LQY2
1 Interpro : A8LQY2
1 Pfam : A8LQY2
1 PIRSF : A8LQY2
1 SUPERFAM : A8LQY2
Sequence
Graphical view for this peptide sequence: dinsh-a8lqy2
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MTDPAPYRADLARAPQDARAVWVRADDGVRLRVALHATGDKGTVLIFPGR
TEWVEKYGRVAGDLASAGYSALVIDWRGQGLSDRLLDDPLKGHVADFPDY
QMDVQAALDCARDAGLPEPYFLIAHSMGGAIGLRAVMQDLPVRGAVFSGP
LWGVKFPLWARPVAGLLGTLSSWFGLGEGYAPSTSPEPYILTAPFHDNLL
TTDRAEYQDMADQMRAEPGFALAGPTMIWVHEANCECKWLATQPSPALPC
LTLLGTNERIVDVGVIHERMARWPGGELVLVEGGEHEVLMESPDKRDPLI
ARMIAFFDAHRGTA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTDPAPYRADLARAPQDARAVWVRADDGVRLRVALHATGDKGTVLIFPGR
TEWVEKYGRVAGDLASAGYSALVIDWRGQGLSDRLLDDPLKGHVADFPDY
QMDVQAALDCARDAGLPEPYFLIAHSMGGAIGLRAVMQDLPVRGAVFSGP
LWGVKFPLWARPVAGLLGTLSSWFGLGEGYAPSTSPEPYILTAPFHDNLL
TTDRAEYQDMADQMRAEPGFALAGPTMIWVHEANCECKWLATQPSPALPC
LTLLGTNERIVDVGVIHERMARWPGGELVLVEGGEHEVLMESPDKRDPLI
ARMIAFFDAHRGTA


Reference
    Title: The complete genome sequence of the algal symbiont Dinoroseobacter shibae: a hitchhiker's guide to life in the sea
    Wagner-Dobler I, Ballhausen B, Berger M, Brinkhoff T, Buchholz I, Bunk B, Cypionka H, Daniel R, Drepper T and Simon M <27 more author(s)>
    Ref: Isme J, 4:61, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer