Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ecolx-h4unx0

Escherichia coli type VI secretion protein tle1; T6SS effector phospholipase Tle1-EAEC

Relationship
Family|Duf_2235
Block| X
Position in NCBI Life Tree|Escherichia coli
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Escherichia: N E > Escherichia coli: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 6SJL, 6SKI
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: WP_000170556, MXI5464, QLV21480
3 UniProt : A0A377LA80, B7LG63, D3GUW5
2 Structure : 6SJL, 6SKI
3 UniProt : A0A377LA80, B7LG63, D3GUW5
3 Interpro : A0A377LA80, B7LG63, D3GUW5
3 Prodom : A0A377LA80, B7LG63, D3GUW5
3 Pfam : A0A377LA80, B7LG63, D3GUW5
3 PIRSF : A0A377LA80, B7LG63, D3GUW5
3 SUPERFAM : A0A377LA80, B7LG63, D3GUW5
Sequence
Graphical view for this peptide sequence: ecolx-h4unx0
Colored MSA for Duf_2235 (raw)
VTLTIGIFFDGTGNNRENTASRLMKFNECSAARQGVNQKDAQSCEDFLKE
INKNSISNGSYRGYYSNIHWLNILYHPDQVLKKDQTSAQIKTYISGIGTA
AGEADSVIGMGLGTSILDIFEGVVTKTDEAMERITQALSEFMGFNLSPDF
CIAKIQFDVFGFSRGAAAARHFANRVMEQDPAIARAIAKGLRGDFYDGKP
SGEVRFLGLFDTVAAIGGISNFFDINGRSNPGVKLELRPSVAKKVFQITA
MNEYRYNFSLNSIKGMWPELALPGAHSDIGGGYNPVGSPLQENESLFLSC
PEFEIVSDDTREM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

VTLTIGIFFDGTGNNRENTASRLMKFNECSAARQGVNQKDAQSCEDFLKE
INKNSISNGSYRGYYSNIHWLNILYHPDQVLKKDQTSAQIKTYISGIGTA
AGEADSVIGMGLGTSILDIFEGVVTKTDEAMERITQALSEFMGFNLSPDF
CIAKIQFDVFGFSRGAAAARHFANRVMEQDPAIARAIAKGLRGDFYDGKP
SGEVRFLGLFDTVAAIGGISNFFDINGRSNPGVKLELRPSVAKKVFQITA
MNEYRYNFSLNSIKGMWPELALPGAHSDIGGGYNPVGSPLQENESLFLSC
PEFEIVSDDTREM


References
    Title: Structural basis for loading and inhibition of a bacterial T6SS phospholipase effector by the VgrG spike
    Flaugnatti N, Rapisarda C, Rey M, Beauvois SG, Nguyen VA, Canaan S, Durand E, Chamot-Rooke J, Cascales E and Journet L <1 more author(s)>
    Ref: EMBO Journal, 39:e104129, 2020 : PubMed

            

    Title: A phospholipase A1 antibacterial Type VI secretion effector interacts directly with the C-terminal domain of the VgrG spike protein for delivery
    Flaugnatti N, Le TT, Canaan S, Aschtgen MS, Nguyen VS, Blangy S, Kellenberger C, Roussel A, Cambillau C and Journet L <1 more author(s)>
    Ref: Molecular Microbiology, 99:1099, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer