Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: giaib-c6lwm0

Giardia lamblia, Giardia intestinalis glp_243_15169_16578 Serine peptidase, putative

Comment
Other strains: Giardia intestinalis (strains ATCC 50803 / WB clone C6; P15; ATCC 50581 / GS clone H7) (Giardia lamblia)


Relationship
Family|Prolylcarboxypeptidase
Block| X
Position in NCBI Life Tree|Giardia lamblia ATCC 50803
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Fornicata: N E > Diplomonadida: N E > Hexamitidae: N E > Giardiinae: N E > Giardia: N E > Giardia intestinalis: N E > Giardia lamblia ATCC 50803: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AACB01000152, ACVC01000229, AACB02000006
2 UniProt : E1F817, A8B8G6
2 UniProt : E1F817, A8B8G6
2 Interpro : E1F817, A8B8G6
2 Pfam : E1F817, A8B8G6
2 PIRSF : E1F817, A8B8G6
2 SUPERFAM : E1F817, A8B8G6
Sequence
Graphical view for this peptide sequence: giaib-c6lwm0
Colored MSA for Prolylcarboxypeptidase (raw)
MLLTLCTLVVTLGRFVQRERIGPSTQLFIENRVDHFNPFNQEVFRQRYYH
NSEFVRNGTRVAILEIGGEGEINSAPGGTKTNPDILGRIADNYGAHIFIL
EHRFYGVSHPFQHASEKYDVGTDKLRYLSSRQAQSDLLHFISVMDDMLCP
ENNRNSTFKRIEGRTCLQWVIVGGSYPGAVTGWIYQRHPSLFAAGLSSSG
VVNARYEIPEFDTHTLMVPGAPCSDALYQAQHEATRQIEAGENNIIYERL
SIRTDADKSDIHYFIADTMLMCFQYGKSKACCDTRLSKAWQEHGDIMGAL
VDYLSTSSFDSYDSANLASDTARHSDAFRQWWWQTCTEVAYYQPAPLMNS
LRSEKITTQWHLDMCKKIFDGLDMGDPTLDTNEFYGGESVKADDVFFSNF
WQDPWHMCSITDDMGGQRDNVGFISCKDCGHCVDLHTPQETDLKELVELR
DRIYSFIVGRVDSILSRGE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLLTLCTLVVTLGRFVQRERIGPSTQLFIENRVDHFNPFNQEVFRQRYYH
NSEFVRNGTRVAILEIGGEGEINSAPGGTKTNPDILGRIADNYGAHIFIL
EHRFYGVSHPFQHASEKYDVGTDKLRYLSSRQAQSDLLHFISVMDDMLCP
ENNRNSTFKRIEGRTCLQWVIVGGSYPGAVTGWIYQRHPSLFAAGLSSSG
VVNARYEIPEFDTHTLMVPGAPCSDALYQAQHEATRQIEAGENNIIYERL
SIRTDADKSDIHYFIADTMLMCFQYGKSKACCDTRLSKAWQEHGDIMGAL
VDYLSTSSFDSYDSANLASDTARHSDAFRQWWWQTCTEVAYYQPAPLMNS
LRSEKITTQWHLDMCKKIFDGLDMGDPTLDTNEFYGGESVKADDVFFSNF
WQDPWHMCSITDDMGGQRDNVGFISCKDCGHCVDLHTPQETDLKELVELR
DRIYSFIVGRVDSILSRGE


References
    Title: Genome analysis and comparative genomics of a Giardia intestinalis assemblage E isolate
    Jerlstrom-Hultqvist J, Franzen O, Ankarklev J, Xu F, Nohynkova E, Andersson JO, Svard SG, Andersson B
    Ref: BMC Genomics, 11:543, 2010 : PubMed

            

    Title: Genomic minimalism in the early diverging intestinal parasite Giardia lamblia
    Morrison HG, McArthur AG, Gillin FD, Aley SB, Adam RD, Olsen GJ, Best AA, Cande WZ, Chen F and Sogin ML <19 more author(s)>
    Ref: Science, 317:1921, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer