Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: giaic-d3kgs7

Giardia intestinalis (strain ATCC 50803 / WB clone C6) (Giardia lamblia) glp_190_48722_47349

Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Giardia lamblia ATCC 50803
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Fornicata: N E > Diplomonadida: N E > Hexamitidae: N E > Giardiinae: N E > Giardia: N E > Giardia intestinalis: N E > Giardia lamblia ATCC 50803: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AACB01000025
1 UniProt : D3KGS7
1 UniProt : D3KGS7
1 Interpro : D3KGS7
1 Pfam : D3KGS7
1 PIRSF : D3KGS7
1 SUPERFAM : D3KGS7
Sequence
Graphical view for this peptide sequence: giaic-d3kgs7
Colored MSA for Lipase_3 (raw)
MQFLVTSLKQIINALYSQGSPLKLSAIRYSNLSSRKLFPLVAGLLTEIPE
VDFKDILLTIRLSTSIYGKEMCHFLHDSRYFLSRFWAWFYSYCPNLIRQF
SCSVTNAERKILADMVAIVKGSLDDVLFFNLKNKDMYQPCWVVMRQPGVQ
RLVIIARGTLSLLDGFTDIDASSEPLSNCFPELTSAPNFYVHRGVLQATI
WMYNSIVPCLHAWIDSELASSRAAKQSPETDTAGFSLLLSGHSLGSAVTV
LLGALLLLKHPDRWTTRNIQCIGYGCPPISNAAFSDWTKDWLTMFIYDMD
IVPRLGDHSLRVRARRAATYKGNIETLESANSISRTLMMSNSLILSGNVY
LIQPTSGYRRYGFCMPKPIYSASSIIGETSLSSLTKVLDASDVYSDAYYH
SPHNGIVKEFENRLYFVTPIDPHDFSETMLSEAALYDHLCYSSIIPHMFD
RRSDPPL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQFLVTSLKQIINALYSQGSPLKLSAIRYSNLSSRKLFPLVAGLLTEIPE
VDFKDILLTIRLSTSIYGKEMCHFLHDSRYFLSRFWAWFYSYCPNLIRQF
SCSVTNAERKILADMVAIVKGSLDDVLFFNLKNKDMYQPCWVVMRQPGVQ
RLVIIARGTLSLLDGFTDIDASSEPLSNCFPELTSAPNFYVHRGVLQATI
WMYNSIVPCLHAWIDSELASSRAAKQSPETDTAGFSLLLSGHSLGSAVTV
LLGALLLLKHPDRWTTRNIQCIGYGCPPISNAAFSDWTKDWLTMFIYDMD
IVPRLGDHSLRVRARRAATYKGNIETLESANSISRTLMMSNSLILSGNVY
LIQPTSGYRRYGFCMPKPIYSASSIIGETSLSSLTKVLDASDVYSDAYYH
SPHNGIVKEFENRLYFVTPIDPHDFSETMLSEAALYDHLCYSSIIPHMFD
RRSDPPL


Reference
    Title: Genomic minimalism in the early diverging intestinal parasite Giardia lamblia
    Morrison HG, McArthur AG, Gillin FD, Aley SB, Adam RD, Olsen GJ, Best AA, Cande WZ, Chen F and Sogin ML <19 more author(s)>
    Ref: Science, 317:1921, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer