Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gorpv-h6mzw9

Gordonia polyisoprenivorans (strains DSM 44266 / VH2; NBRC 16320) Putative carboxylesterase

Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Gordonia polyisoprenivorans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Gordoniaceae: N E > Gordonia: N E > Gordonia polyisoprenivorans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : BAEI01000056, CP003119
1 UniProt : H6MZW9
1 UniProt : H6MZW9
1 Interpro : H6MZW9
1 Pfam : H6MZW9
1 PIRSF : H6MZW9
1 SUPERFAM : H6MZW9
Sequence
Graphical view for this peptide sequence: gorpv-h6mzw9
Colored MSA for Carb_B_Bacteria (raw)
MTRADVHAPVVSIAGGAVSGSTTDGISAFLGIPYAAPPVGPDAFAAPKPA
PSWDGVRDATAYGPTAPQAPYPAPIAALLDNVIVDGDDYLNLNVWTPDPG
GAGLPVMVWIHGGAFTRGSNRITMYAGDTFARDGVVCVGINYRLGTPGFA
SVAGAPENRGLLDQIAALRWVRENISAFGGDPDNITVFGESAGAMSVASL
LSSPRADGLFGRAIMESGNGNAAADPADARKVTDRLAALLRVDATADALG
QVSGDELLKAQTQVALELMLAPDPQVWGESIVKVGLGIMSQFPVIDGDVL
TARPVDAIGAGTSASVPLLAGWNADEFRFFMVATGGASAVTEEGASAMLG
STDGGAAFLRNRLDAGVSPGDALSEALSRAAFSGPTTTIAEVRGSAQGER
AATHLYEFGYESPQGDIRAGHAVEIPFVFDHLDEAHALVGPEPDQRIADD
MHATWVRFATSGDPGWSPYASGGEIRRFD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTRADVHAPVVSIAGGAVSGSTTDGISAFLGIPYAAPPVGPDAFAAPKPA
PSWDGVRDATAYGPTAPQAPYPAPIAALLDNVIVDGDDYLNLNVWTPDPG
GAGLPVMVWIHGGAFTRGSNRITMYAGDTFARDGVVCVGINYRLGTPGFA
SVAGAPENRGLLDQIAALRWVRENISAFGGDPDNITVFGESAGAMSVASL
LSSPRADGLFGRAIMESGNGNAAADPADARKVTDRLAALLRVDATADALG
QVSGDELLKAQTQVALELMLAPDPQVWGESIVKVGLGIMSQFPVIDGDVL
TARPVDAIGAGTSASVPLLAGWNADEFRFFMVATGGASAVTEEGASAMLG
STDGGAAFLRNRLDAGVSPGDALSEALSRAAFSGPTTTIAEVRGSAQGER
AATHLYEFGYESPQGDIRAGHAVEIPFVFDHLDEAHALVGPEPDQRIADD
MHATWVRFATSGDPGWSPYASGGEIRRFD


Reference
    Title: Involvement of two latex-clearing proteins during rubber degradation and insights into the subsequent degradation pathway revealed by the genome sequence of Gordonia polyisoprenivorans strain VH2
    Hiessl S, Schuldes J, Thurmer A, Halbsguth T, Broker D, Angelov A, Liebl W, Daniel R, Steinbuchel A
    Ref: Applied Environmental Microbiology, 78:2874, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer