Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: haloh-b8czv0

Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562). Alpha/beta hydrolase fold protein

Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Halothermothrix orenii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Clostridia: N E > Halanaerobiales: N E > Halanaerobiaceae: N E > Halothermothrix: N E > Halothermothrix orenii: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP001098
1 UniProt : B8CZV0
1 UniProt : B8CZV0
1 Interpro : B8CZV0
1 Pfam : B8CZV0
1 PIRSF : B8CZV0
1 SUPERFAM : B8CZV0
Sequence
Graphical view for this peptide sequence: haloh-b8czv0
Colored MSA for Proline_iminopeptidase (raw)
MKKSINKRKVVMSMTVIVIALIGLMFIMPAGTEPILDANGEVIPGSIATM
EKIELGGVEQWVVIRGKSVNNPILLLLSGGPGASEMGRFLKYNKDLEDDF
IVVNWEQRGCGKSYPAIKDKESMTVEQYVADINELTGYLKKRFNKEKIYL
LGHSWGTIIGTMAVQKFPDQFYAYIGAAQMVNIAKTDQYMYRYVLNAARK
AGDDKLVSKLMASGEPPYYGEGMLNKYRLFLTSYAGYYRAENPFNEKNRE
WYTLSSMIMLKEYSWLDRIRYFQGLLKTYPLVYSQLQDINFVTQANRLEI
PVYYLIGKHDYTAKFIEEYYQNLQAPSKELIWFEHSAHGEIWTEPDKFHD
IMVNKVLPETYFN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKSINKRKVVMSMTVIVIALIGLMFIMPAGTEPILDANGEVIPGSIATM
EKIELGGVEQWVVIRGKSVNNPILLLLSGGPGASEMGRFLKYNKDLEDDF
IVVNWEQRGCGKSYPAIKDKESMTVEQYVADINELTGYLKKRFNKEKIYL
LGHSWGTIIGTMAVQKFPDQFYAYIGAAQMVNIAKTDQYMYRYVLNAARK
AGDDKLVSKLMASGEPPYYGEGMLNKYRLFLTSYAGYYRAENPFNEKNRE
WYTLSSMIMLKEYSWLDRIRYFQGLLKTYPLVYSQLQDINFVTQANRLEI
PVYYLIGKHDYTAKFIEEYYQNLQAPSKELIWFEHSAHGEIWTEPDKFHD
IMVNKVLPETYFN


Reference
    Title: Genome analysis of the anaerobic thermohalophilic bacterium Halothermothrix orenii
    Mavromatis K, Ivanova N, Anderson I, Lykidis A, Hooper SD, Sun H, Kunin V, Lapidus A, Hugenholtz P and Kyrpides NC <1 more author(s)>
    Ref: PLoS ONE, 4:e4192, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer