Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: helam-d5g3d4

Helicoverpa armigera (Cotton bollworm) (Heliothis armigera) Carboxyl/choline esterase CCE001g CarE001G

Comment
g0t5q2 quite different only n-term Pfam A COesterase 2 526 the c-term with NGGEGDGGNG repeat is not represented here. Metabolize beta-cypermethrin, lambda-cyhalothrin and fenvalerate. Carboxylesterase 001G


Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Helicoverpa armigera
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Obtectomera: N E > Noctuoidea: N E > Noctuidae: N E > Heliothinae: N E > Helicoverpa: N E > Helicoverpa armigera: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





3 substrates: Cypermethrin, Fenvalerate, lambda-Cyhalothrin
No inhibitor
>3 Genbank links 1 more: FJ997298, GU119888, KT345938
3 UniProt : D5G3D4, G0T5Q2, A0A127KQ69
>3 UniProt links 1 more: D5G3D4, G0T5Q2, S4WFZ6
>3 Interpro links 1 more: D5G3D4, G0T5Q2, S4WFZ6
>3 Pfam links 1 more: D5G3D4, G0T5Q2, S4WFZ6
>3 PIRSF links 1 more: D5G3D4, G0T5Q2, S4WFZ6
>3 SUPERFAM links 1 more: D5G3D4, G0T5Q2, S4WFZ6
Sequence
Graphical view for this peptide sequence: helam-d5g3d4
Colored MSA for Carb_B_Arthropoda (raw)
MWWRTCVVLVCVTAVLADEEWRQVNTAQGPVRGQKHPSGHLYAFYNVPYA
TAPKGIHKFKAPLPPPVRTEPFDAVNKNVVCPQYIDMDSKMPGRHLEQSE
DCLIANIFVPDTNENNLPVLVYVHGGAFILGFGDMMRATQLMKSKDFIMV
TFNYRLGIHGFLCLGTEDVPGNAGLKDQVALLRWVKDNIANFGGNPNKVT
LAGYSAGSTSVDLLMLSKAAKGLFHRVIPESGANLAAFGMQRDPLEVAKS
HAKTLQFTNVEDISALEQFYKTASMALLTEDSFLLRPDSTFLFGPCVERD
TEGAFLTESPLTILKNGDYEKLPMLYGFANMEGLFRIDMFNDWKDKMNSN
FAEFLPADLKFETDGAKEEVIELIKKFYFGGQPVSNDNILRYVDYFSDVP
FVYPTLRSAKLQVEAGNDQVYLYEYSFVDENDNVVPHTNVRGADHVAQTV
ALMDGEDESLKSQAYQNMRKIIREIWHNFIITGTPVPADSSLPAWPPARA
DRSPHMRLLEKPVLQGVLLGERAQFWDDIYEKYYLDAVPPAAPNT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWWRTCVVLVCVTAVLADEEWRQVNTAQGPVRGQKHPSGHLYAFYNVPYA
TAPKGIHKFKAPLPPPVRTEPFDAVNKNVVCPQYIDMDSKMPGRHLEQSE
DCLIANIFVPDTNENNLPVLVYVHGGAFILGFGDMMRATQLMKSKDFIMV
TFNYRLGIHGFLCLGTEDVPGNAGLKDQVALLRWVKDNIANFGGNPNKVT
LAGYSAGSTSVDLLMLSKAAKGLFHRVIPESGANLAAFGMQRDPLEVAKS
HAKTLQFTNVEDISALEQFYKTASMALLTEDSFLLRPDSTFLFGPCVERD
TEGAFLTESPLTILKNGDYEKLPMLYGFANMEGLFRIDMFNDWKDKMNSN
FAEFLPADLKFETDGAKEEVIELIKKFYFGGQPVSNDNILRYVDYFSDVP
FVYPTLRSAKLQVEAGNDQVYLYEYSFVDENDNVVPHTNVRGADHVAQTV
ALMDGEDESLKSQAYQNMRKIIREIWHNFIITGTPVPADSSLPAWPPARA
DRSPHMRLLEKPVLQGVLLGERAQFWDDIYEKYYLDAVPPAAPNT


References
1 more
    Title: Enhanced hydrolysis of beta-cypermethrin caused by deletions in the glycin-rich region of carboxylesterase 001G from Helicoverpa armigera
    Bai LS, Xu JJ, Zhao CX, Chang YL, Dong YL, Zhang KG, Li YQ, Li YP, Ma ZQ, Liu XL
    Ref: Pest Manag Sci, 77:2129, 2021 : PubMed

            

    Title: Identification and biochemical characterization of carboxylesterase 001G associated with insecticide detoxification in Helicoverpa armigera
    Bai LS, Zhao CX, Xu JJ, Feng C, Li YQ, Dong YL, Ma ZQ
    Ref: Pestic Biochem Physiol, 157:69, 2019 : PubMed

            

    Title: Gene identification and proteomic analysis of the esterases of the cotton bollworm, Helicoverpa armigera
    Teese MG, Campbell PM, Scott C, Gordon KH, Southon A, Hovan D, Robin C, Russell RJ, Oakeshott JG
    Ref: Insect Biochemistry & Molecular Biology, 40:1, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer