Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: helam-d5kx87

Helicoverpa armigera (Cotton bollworm) (Heliothis armigera) Carboxylesterase CarE 001C CCE001c

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Helicoverpa armigera
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Obtectomera: N E > Noctuoidea: N E > Noctuidae: N E > Heliothinae: N E > Helicoverpa: N E > Helicoverpa armigera: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





2 substrates: Cypermethrin, Fenvalerate
No inhibitor
Sequence
Graphical view for this peptide sequence: helam-d5kx87
Colored MSA for Carb_B_Arthropoda (raw)
MMKWWTCVVFMCAAVLADDEWREVRTAQGPVRGRKHPTEDIYAFYNIPYA
TAPTGKDKFKGPLPPPVWSETFDAVDEYVMCPQAKSPWDMLMPKNRVVKE
NCLIANVYVPNTKEKNLSVLVIVHGGAFLMGSGEQLKGTKFMNTKDFIIV
TFNYRLGIHGFLCLGTEDAPGNAGMKDQVALLRWVQKNIASFGGNPDDVT
IDGYSAGSVSVDLLMLSKSAEGLFQRVIPESGGNLAALAIQRDPVEIAKT
HARKLNFTNVDDIYALEDFYRKAPLELLLTPDDLFDRTDSILTFSPCVER
DTGDGAFLTESPLTILKSGNYRKLPLLYGFTNMEGLLRIGFFDIWKHKVN
EKFSDFLPPDLKFDSDEEREEVANKIKRFYFGDKPVGNDNILKYVDFFSD
VIFAYPMLRAVKLHAEAGNNQVYLYEYSFVDEDIPLVPYTNVRGADHRAQ
SMALFDGKNLTQSDESQAIPEYQNMMKIIREIWHNFLKTGVPVPEGSVLP
AWPAAGADRAPHMSLGERLELRGALLAERTRFWDDIYQRYYRDAVPPPKP
PPRPRNEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMKWWTCVVFMCAAVLADDEWREVRTAQGPVRGRKHPTEDIYAFYNIPYA
TAPTGKDKFKGPLPPPVWSETFDAVDEYVMCPQAKSPWDMLMPKNRVVKE
NCLIANVYVPNTKEKNLSVLVIVHGGAFLMGSGEQLKGTKFMNTKDFIIV
TFNYRLGIHGFLCLGTEDAPGNAGMKDQVALLRWVQKNIASFGGNPDDVT
IDGYSAGSVSVDLLMLSKSAEGLFQRVIPESGGNLAALAIQRDPVEIAKT
HARKLNFTNVDDIYALEDFYRKAPLELLLTPDDLFDRTDSILTFSPCVER
DTGDGAFLTESPLTILKSGNYRKLPLLYGFTNMEGLLRIGFFDIWKHKVN
EKFSDFLPPDLKFDSDEEREEVANKIKRFYFGDKPVGNDNILKYVDFFSD
VIFAYPMLRAVKLHAEAGNNQVYLYEYSFVDEDIPLVPYTNVRGADHRAQ
SMALFDGKNLTQSDESQAIPEYQNMMKIIREIWHNFLKTGVPVPEGSVLP
AWPAAGADRAPHMSLGERLELRGALLAERTRFWDDIYQRYYRDAVPPPKP
PPRPRNEL


References
    Title: Two single mutations in carboxylesterase 001C improve fenvalerate hydrolase activity in Helicoverpa armigera
    Xu JJ, Chang YM, Lu M, Tie Y, Dong YL, Chen GY, Ma ZQ, Liu XL, Li YQ
    Ref: Pestic Biochem Physiol, 179:104969, 2021 : PubMed

            

    Title: Organophosphate and pyrethroid hydrolase activities of mutant Esterases from the cotton bollworm Helicoverpa armigera
    Li Y, Farnsworth CA, Coppin CW, Teese MG, Liu JW, Scott C, Zhang X, Russell RJ, Oakeshott JG
    Ref: PLoS ONE, 8:e77685, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer