Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-ABHD15

Homo sapiens (Human) ABH15 Abhydrolase domain-containing protein 15 hypothetical protein

Comment
ABHD15 does not have a serine in the position of the catalytic triad. TAMRA-FP probe does not interact with ABHD15. ABHD15 has no hydrolase activity


Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: BC012476, AY358212, AC104564
1 UniProt : Q6UXT9
2 UniProt : Q6UXT9, Q96EC5
2 Interpro : Q6UXT9, Q96EC5
2 Prodom : Q6UXT9, Q96EC5
2 Pfam : Q6UXT9, Q96EC5
2 PIRSF : Q6UXT9, Q96EC5
2 SUPERFAM : Q6UXT9, Q96EC5
1 EntrezGene : 116236
1 SNP : 116236
1 UniGene : 106510
1 HUGO HGNC : 26971
1 Ensembl : ENSG00000168792
Sequence
Graphical view for this peptide sequence: human-ABHD15
Colored MSA for abh_upf0017 (raw)
MPPWGAALALILAVLALLGLLGPRLRGPWGRAVGERTLPGAQDRDDGEEA
DGGGPADQFSDGREPLPGGCSLVCKPSALAQCLLRALRRSEALEAGPRSW
FSGPHLQTLCHFVLPVAPGPELAREYLQLADDGLVALDWVVGPCVRGRRI
TSAGGLPAVLLVIPNAWGRLTRNVLGLCLLALERGYYPVIFHRRGHHGCP
LVSPRLQPFGDPSDLKEAVTYIRFRHPAAPLFAVSEGSGSALLLSYLGEC
GSSSYVTGAACISPVLRCREWFEAGLPWPYERGFLLYQKIALSRYATALE
DTVDTSRLFRSRSLREFEEALFCHTKSFPISWDAYWDRNDPLRDVDEAAV
PVLCICSADDPVCGPPDHTLTTELFHSNPYFFLLLSRHGGHCGFLRQEPL
PAWSHEVILESFRALTEFFRTEERIKGLSRHRASFLGGRRRGGALQRREV
SSSSNLEEIFNWKRSYTR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPPWGAALALILAVLALLGLLGPRLRGPWGRAVGERTLPGAQDRDDGEEA
DGGGPADQFSDGREPLPGGCSLVCKPSALAQCLLRALRRSEALEAGPRSW
FSGPHLQTLCHFVLPVAPGPELAREYLQLADDGLVALDWVVGPCVRGRRI
TSAGGLPAVLLVIPNAWGRLTRNVLGLCLLALERGYYPVIFHRRGHHGCP
LVSPRLQPFGDPSDLKEAVTYIRFRHPAAPLFAVSEGSGSALLLSYLGEC
GSSSYVTGAACISPVLRCREWFEAGLPWPYERGFLLYQKIALSRYATALE
DTVDTSRLFRSRSLREFEEALFCHTKSFPISWDAYWDRNDPLRDVDEAAV
PVLCICSADDPVCGPPDHTLTTELFHSNPYFFLLLSRHGGHCGFLRQEPL
PAWSHEVILESFRALTEFFRTEERIKGLSRHRASFLGGRRRGGALQRREV
SSSSNLEEIFNWKRSYTR


References
2 more
    Title: ABHD15 regulates adipose tissue lipolysis and hepatic lipid accumulation
    Stockli J, Zadoorian A, Cooke KC, Deshpande V, Yau B, Herrmann G, Kebede MA, Humphrey SJ, James DE
    Ref: Mol Metab, 25:83, 2019 : PubMed

            

    Title: alpha/beta-Hydrolase Domain Containing Protein 15 (ABHD15) - an Adipogenic Protein Protecting from Apoptosis
    Walenta E, Pessentheiner AR, Pelzmann HJ, Deutsch A, Goeritzer M, Kratky D, Hackl H, Oh da Y, Prokesch A, Bogner-Strauss JG
    Ref: PLoS ONE, 8:e79134, 2013 : PubMed

            

    Title: The 47kDa Akt substrate associates with phosphodiesterase 3B and regulates its level in adipocytes
    Chavez JA, Gridley S, Sano H, Lane WS, Lienhard GE
    Ref: Biochemical & Biophysical Research Communications, 342:1218, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer