Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: hyaae-m4b4d8

Hyaloperonospora arabidopsidis (strain Emoy2) (Downy mildew agent) (Peronospora arabidopsidis) Uncharacterized protein

Relationship
Family|ABHD6-Lip
Block| X
Position in NCBI Life Tree|Hyaloperonospora arabidopsidis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Stramenopiles: N E > Oomycetes: N E > Peronosporales: N E > Peronosporaceae: N E > Hyaloperonospora: N E > Hyaloperonospora arabidopsidis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 UniProt : M4B4D8
1 UniProt : M4B4D8
1 Interpro : M4B4D8
1 Pfam : M4B4D8
1 PIRSF : M4B4D8
1 SUPERFAM : M4B4D8
Sequence
Graphical view for this peptide sequence: hyaae-m4b4d8
Colored MSA for ABHD6-Lip (raw)
MGLLRVFGAFGSTTASLVRFGKRFEARSATVDQFQWSYLIRPAADPKSRE
VVVFLHGLGSSKEAWVRVSSGLSKNYHVIIPDLPGHGKTTPLDPRVNFAA
DRQTRRLHEFLESELYPNNKVHLVGTCIGATVAGLYAAMHPTRVKSLSLL
CPWGISDSKATSATLSDIERLGNKITLQSPTATSTSDVSECRDYAVSVKH
ILRVFRDLRIYKRGREWQVLQKVGVDTLAHPSILEDELDNIRARTMVVWG
KQDNFLDVSCLKVLDDKLNATHKHVLVLDECGHLITSDKPVECIDLLNKF
LGDFQLSFPSALVE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGLLRVFGAFGSTTASLVRFGKRFEARSATVDQFQWSYLIRPAADPKSRE
VVVFLHGLGSSKEAWVRVSSGLSKNYHVIIPDLPGHGKTTPLDPRVNFAA
DRQTRRLHEFLESELYPNNKVHLVGTCIGATVAGLYAAMHPTRVKSLSLL
CPWGISDSKATSATLSDIERLGNKITLQSPTATSTSDVSECRDYAVSVKH
ILRVFRDLRIYKRGREWQVLQKVGVDTLAHPSILEDELDNIRARTMVVWG
KQDNFLDVSCLKVLDDKLNATHKHVLVLDECGHLITSDKPVECIDLLNKF
LGDFQLSFPSALVE


Reference
    Title: Signatures of adaptation to obligate biotrophy in the Hyaloperonospora arabidopsidis genome
    Baxter L, Tripathy S, Ishaque N, Boot N, Cabral A, Kemen E, Thines M, Ah-Fong A, Anderson R and Tyler BM <42 more author(s)>
    Ref: Science, 330:1549, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer