Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lacpl-LP.2923

Lactobacillus plantarum Cest-2923 (lp_2923) lipase/esterase

Comment
Other strains: Lactobacillus plantarum (strains ST-III; subsp. plantarum ATCC 14917; JDM1)


Relationship
Family|BD-FAE
Block| H
Position in NCBI Life Tree|Lactobacillus plantarum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Lactobacillaceae: N E > Lactobacillus: N E > Lactobacillus plantarum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
5 structures (e.g. : 3BXP, 3D3N, 4BZW... more)
No kinetic





2 substrates: Isopropenyl-acetate, Phenylacetate
1 inhbitor:
HEPES
1 Genbank : AL935260
1 UniProt : D7VDB7
>3 Structure links 2 more: 3D3N, 4BZW, 4BZZ
1 UniProt : D7VDB7
1 Interpro : D7VDB7
1 Prodom : D7VDB7
1 Pfam : D7VDB7
1 PIRSF : D7VDB7
1 SUPERFAM : D7VDB7
Sequence
Graphical view for this peptide sequence: lacpl-LP.2923
Colored MSA for BD-FAE (raw)
MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSG
REEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQA
SAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAI
ILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTAT
DESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKY
LNDQAAIWPQLALRWLQEQGLLAGNY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSG
REEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQA
SAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAI
ILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTAT
DESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKY
LNDQAAIWPQLALRWLQEQGLLAGNY


References
    Title: Structure, biochemical characterization and analysis of the pleomorphism of carboxylesterase Cest-2923 from Lactobacillus plantarum WCFS1
    Benavente R, Esteban-Torres M, Acebron I, de Las Rivas B, Munoz R, Alvarez Y, Mancheno JM
    Ref: Febs J, 280:6658, 2013 : PubMed

            

    Title: Complete genome sequence of Lactobacillus plantarum JDM1
    Zhang ZY, Liu C, Zhu YZ, Zhong Y, Zhu YQ, Zheng HJ, Zhao GP, Wang SY, Guo XK
    Ref: Journal of Bacteriology, 191:5020, 2009 : PubMed

            

    Title: Complete genome sequence of Lactobacillus plantarum WCFS1
    Kleerebezem M, Boekhorst J, van Kranenburg R, Molenaar D, Kuipers OP, Leer R, Tarchini R, Peters SA, Sandbrink HM and Siezen RJ <10 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:1990, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer