Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: macmu-f6rbn1

Macaca mulatta (Rhesus macaque); Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey) Carboxypeptidase CTSA

Comment
Other strains: Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey)


Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Macaca mulatta
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Cercopithecoidea: N E > Cercopithecidae: N E > Cercopithecinae: N E > Macaca: N E > Macaca mulatta: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB169583
>3 UniProt links 1 more: F6RBN1, Q4R5G0, F7G1E1
2 UniProt : F6RBN1, Q4R5G0
2 Interpro : F6RBN1, Q4R5G0
2 Prodom : F6RBN1, Q4R5G0
2 Pfam : F6RBN1, Q4R5G0
2 PIRSF : F6RBN1, Q4R5G0
2 SUPERFAM : F6RBN1, Q4R5G0
Sequence
Graphical view for this peptide sequence: macmu-f6rbn1
Colored MSA for Carboxypeptidase_S10 (raw)
MTSSPRAPPGEQGHGGAEMIRAAPPLLFLLLLLVSWAPRGEAAPDQDEIQ
RLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGP
GCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSY
SDDKFYATNDTEVAQSNFEALQDFFHLFPEYKNNKLFLTGESYAGIYIPT
LAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSL
QTHCCSQNKCNFYDNKDPECVTNLQEVARIVGNSGLNIYNLYAPCAGGVP
SHFRYEKDTVVVQDLGNIFTRLPLKRTWHQALLRSGDKVRMDPPCTNTTA
ASTYLNNPYVRKALHIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLS
SQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQ
IAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTSSPRAPPGEQGHGGAEMIRAAPPLLFLLLLLVSWAPRGEAAPDQDEIQ
RLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGP
GCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSY
SDDKFYATNDTEVAQSNFEALQDFFHLFPEYKNNKLFLTGESYAGIYIPT
LAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSL
QTHCCSQNKCNFYDNKDPECVTNLQEVARIVGNSGLNIYNLYAPCAGGVP
SHFRYEKDTVVVQDLGNIFTRLPLKRTWHQALLRSGDKVRMDPPCTNTTA
ASTYLNNPYVRKALHIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLS
SQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQ
IAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY


Reference
    Title: Substitution rate and structural divergence of 5'UTR evolution: comparative analysis between human and cynomolgus monkey cDNAs
    Osada N, Hirata M, Tanuma R, Kusuda J, Hida M, Suzuki Y, Sugano S, Gojobori T, Shen CK and Hashimoto K <1 more author(s)>
    Ref: Molecular Biology Evolution, 22:1976, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer