Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: metbs-pks2

Metarhizium brunneum (strain ARSEF 3297). Polyketide synthase 2. Thioesterase domain

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Metarhizium brunneum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Clavicipitaceae: N E > Metarhizium: N E > Metarhizium brunneum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AZNG01000004, XP_014545211
1 UniProt : A0A0B4H8J1
1 UniProt : A0A0B4H8J1
1 Interpro : A0A0B4H8J1
1 Pfam : A0A0B4H8J1
1 PIRSF : A0A0B4H8J1
1 SUPERFAM : A0A0B4H8J1
Sequence
Graphical view for this peptide sequence: metbs-pks2
Colored MSA for Thioesterase (raw)
GVDSLLSLTITGRIREELGLDMDSSIFTHYSTLGELKAFLGADQLPDDAV
ACESSNGQHTPQTSDKGSGTLAAQKPDDDIGPDTTLNRVCAIIAEEVGIS
VQELSSSQDFQELGIDSLSSLTILSRVREELQLDLESDFFDTHPSFYSLQ
KALCGTGAASNGATEANETTPSSHRLESDLRSITWQSGQNIVASPPHATS
ILVSGSPSTARMILVLFPDGSGSAASYGALAPKIRRDIAVYALNCPWRTN
GEEILRLGVTLDTMVAKHLVEVGRILDSHRHGRPGSGNSSVGLALGGWSA
GGILALEAVRQLGEAGVAVQKMVLLDAPNPIGLQNPPPRMFHFLDELGIL
GAGKGKAPAWVLRHFDAMVNLLKSYRPRRLEAEDAPKCLIVYARDGICKD
PDGPRMDTKPDDAREMLWLLYNRVDFSAEGWKTLVGQQNLAVGVVEDVNH
FSMMNPGPKMVEMGNLIGEFLLGPS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GVDSLLSLTITGRIREELGLDMDSSIFTHYSTLGELKAFLGADQLPDDAV
ACESSNGQHTPQTSDKGSGTLAAQKPDDDIGPDTTLNRVCAIIAEEVGIS
VQELSSSQDFQELGIDSLSSLTILSRVREELQLDLESDFFDTHPSFYSLQ
KALCGTGAASNGATEANETTPSSHRLESDLRSITWQSGQNIVASPPHATS
ILVSGSPSTARMILVLFPDGSGSAASYGALAPKIRRDIAVYALNCPWRTN
GEEILRLGVTLDTMVAKHLVEVGRILDSHRHGRPGSGNSSVGLALGGWSA
GGILALEAVRQLGEAGVAVQKMVLLDAPNPIGLQNPPPRMFHFLDELGIL
GAGKGKAPAWVLRHFDAMVNLLKSYRPRRLEAEDAPKCLIVYARDGICKD
PDGPRMDTKPDDAREMLWLLYNRVDFSAEGWKTLVGQQNLAVGVVEDVNH
FSMMNPGPKMVEMGNLIGEFLLGPS


References
    Title: Duplication of a Pks gene cluster and subsequent functional diversification facilitate environmental adaptation in Metarhizium species
    Zeng G, Zhang P, Zhang Q, Zhao H, Li Z, Zhang X, Wang C, Yin WB, Fang W
    Ref: PLoS Genet, 14:e1007472, 2018 : PubMed

            

    Title: Trajectory and genomic determinants of fungal-pathogen speciation and host adaptation
    Hu X, Xiao G, Zheng P, Shang Y, Su Y, Zhang X, Liu X, Zhan S, St Leger RJ, Wang C
    Ref: Proc Natl Acad Sci U S A, 111:16796, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer