Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-ndr3

Mus musculus (Mouse) ndrg3 protein (ndr3 protein)

Relationship
Family|Ndr_family
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AB033922, AK036277, AK037487
>3 UniProt links 1 more: Q9QYF9, Q544I1, Q8VCV2
>3 UniProt links 1 more: Q9QYF9, Q8VCV2, Q8CBD0
>3 Interpro links 1 more: Q9QYF9, Q8VCV2, Q8CBD0
>3 Pfam links 1 more: Q9QYF9, Q8VCV2, Q8CBD0
>3 PIRSF links 1 more: Q9QYF9, Q8VCV2, Q8CBD0
>3 SUPERFAM links 1 more: Q9QYF9, Q8VCV2, Q8CBD0
1 MGD : 1352499
2 ENSEMBL : Q9QYF9, ENSMUSG00000027634
Sequence
Graphical view for this peptide sequence: mouse-ndr3
Colored MSA for Ndr_family (raw)
MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETPHGMVHVTIRGLP
KGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEA
APSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALN
HPELVEGLVLINIDPCAKGWIDWAASKLSGFTTNIVDIILAHHFGQEELQ
ANLDLIQTYRLHIAQDINQENLQLFLGSYNGRRDLEIERPILGQNDNRLK
TLKCSTLLVVGDNSPAVEAVVECNSRLDPINTTLLKMADCGGLPQVVQPG
KLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSIGSGESPFSRSVTSN
QSDGTQESCESPDVLDRHQTMEVSC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETPHGMVHVTIRGLP
KGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEA
APSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALN
HPELVEGLVLINIDPCAKGWIDWAASKLSGFTTNIVDIILAHHFGQEELQ
ANLDLIQTYRLHIAQDINQENLQLFLGSYNGRRDLEIERPILGQNDNRLK
TLKCSTLLVVGDNSPAVEAVVECNSRLDPINTTLLKMADCGGLPQVVQPG
KLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSIGSGESPFSRSVTSN
QSDGTQESCESPDVLDRHQTMEVSC


References
    Title: Glycogen Storage Disease Phenotypes Accompanying the Perturbation of the Methionine Cycle in NDRG3-Deficient Mouse Livers
    Sohn HA, Lee DC, Park A, Kang M, Yoon BH, Lee CH, Kim YH, Oh KJ, Kim CY and Yeom YI <7 more author(s)>
    Ref: Cells, 11:, 2022 : PubMed

            

    Title: Increased Expression of NDRG3 in Mouse Uterus During Embryo Implantation and in Mouse Endometrial Stromal Cells During In Vitro Decidualization
    Yang Q, Zhang X, Shi Y, He YP, Sun ZG, Shi HJ, Wang J
    Ref: Reprod Sci, :1933719117737843, 2017 : PubMed

            

    Title: Identification of new genes ndr2 and ndr3 which are related to Ndr1/RTP/Drg1 but show distinct tissue specificity and response to N-myc
    Okuda T, Kondoh H
    Ref: Biochemical & Biophysical Research Communications, 266:208, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer