Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycap-a5iy19

Mycoplasma agalactiae (strains PG2; 5632) Esterase/lipase

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Mycoplasma agalactiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Tenericutes: N E > Mollicutes: N E > Mycoplasmatales: N E > Mycoplasmataceae: N E > Mycoplasma: N E > Mycoplasma agalactiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CU179680, FP671138
2 UniProt : A5IY19, D3VPR7
2 UniProt : A5IY19, D3VPR7
2 Interpro : A5IY19, D3VPR7
2 Pfam : A5IY19, D3VPR7
2 PIRSF : A5IY19, D3VPR7
2 SUPERFAM : A5IY19, D3VPR7
Sequence
Graphical view for this peptide sequence: mycap-a5iy19
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MEKVIYDYEYVFKDNGNKDGAIIYCHGHNSKPKIFEMFQNYWTKTNYYAI
QFPGNNLVKPVKDHKLNVNQFAQLLVDFITNNGLKNVTLIGHSMGGGTIS
LAYKLRPDLISKLIYIAPINKTTSLSKGKYRRNFAPTTLSEYHDFLRPLY
YDFDKLIANSEFSEEVKKAFDPERFSNEYIKELTMSMDSSLYDQIESALD
SIKIPTLLILGEKDGVIDSEACLEYFKEHVKNLESIIVPKSAHIIYLENW
PVFIEAVEKFLCK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEKVIYDYEYVFKDNGNKDGAIIYCHGHNSKPKIFEMFQNYWTKTNYYAI
QFPGNNLVKPVKDHKLNVNQFAQLLVDFITNNGLKNVTLIGHSMGGGTIS
LAYKLRPDLISKLIYIAPINKTTSLSKGKYRRNFAPTTLSEYHDFLRPLY
YDFDKLIANSEFSEEVKKAFDPERFSNEYIKELTMSMDSSLYDQIESALD
SIKIPTLLILGEKDGVIDSEACLEYFKEHVKNLESIIVPKSAHIIYLENW
PVFIEAVEKFLCK


References
    Title: Comparative genomic and proteomic analyses of two Mycoplasma agalactiae strains: clues to the macro- and micro-events that are shaping mycoplasma diversity
    Nouvel LX, Sirand-Pugnet P, Marenda MS, Sagne E, Barbe V, Mangenot S, Schenowitz C, Jacob D, Barre A and Citti C <2 more author(s)>
    Ref: BMC Genomics, 11:86, 2010 : PubMed

            

    Title: Being pathogenic, plastic, and sexual while living with a nearly minimal bacterial genome
    Sirand-Pugnet P, Lartigue C, Marenda M, Jacob D, Barre A, Barbe V, Schenowitz C, Mangenot S, Couloux A and Citti C <3 more author(s)>
    Ref: PLoS Genet, 3:e75, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer