Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mycle-MLCB22.16c

Mycobacterium leprae (and strain Br4923) MLCB22.16c gene

Comment
only n-term Pfam A Abhydrolase_6 36 297


Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Mycobacterium leprae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium leprae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: Z98741, X81372, X57653
1 Ncbi-nid : 2342602
1 Ncbi-pid : 2342610
1 UniProt : O32958
1 Interpro : O32958
1 Prodom : O32958
1 Pfam : O32958
1 PIRSF : O32958
1 SUPERFAM : O32958
Sequence
Graphical view for this peptide sequence: mycle-MLCB22.16c
Colored MSA for Epoxide_hydrolase (raw)
MPATQSIHKVPHQFVESPDGVRLAIYQSGQPEGPAIVLVHGFPDSHVLWD
GVVPLLAKRFRIVRYDNRGVGQSSVPKPVSAYTMTRFADDFAAVIDELSP
DRPVHVLAHDWGSVGVWEYLSRSGASDRVASFTSVSGPSQDQLVDYILSG
LRRPWRPRTFARAVSQLFRLTYMVLFSIPVLVPMVLWIALSSATIRRTMV
DNISTDQIHHSATLARDAAHSVKTYPANYFRAFSGRRRGKGVPVVNVPVQ
LIVNTMDRYVRPYGYDATARWVPRLWRRDIKAGHFSPMSHPQVMAAAVHD
LADLVDGKQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPATQSIHKVPHQFVESPDGVRLAIYQSGQPEGPAIVLVHGFPDSHVLWD
GVVPLLAKRFRIVRYDNRGVGQSSVPKPVSAYTMTRFADDFAAVIDELSP
DRPVHVLAHDWGSVGVWEYLSRSGASDRVASFTSVSGPSQDQLVDYILSG
LRRPWRPRTFARAVSQLFRLTYMVLFSIPVLVPMVLWIALSSATIRRTMV
DNISTDQIHHSATLARDAAHSVKTYPANYFRAFSGRRRGKGVPVVNVPVQ
LIVNTMDRYVRPYGYDATARWVPRLWRRDIKAGHFSPMSHPQVMAAAVHD
LADLVDGKQ


References
    Title: Comparative genomic and phylogeographic analysis of Mycobacterium leprae
    Monot M, Honore N, Garnier T, Zidane N, Sherafi D, Paniz-Mondolfi A, Matsuoka M, Taylor GM, Donoghue HD and Cole ST <21 more author(s)>
    Ref: Nat Genet, 41:1282, 2009 : PubMed

            

    Title: Use of an ordered cosmid library to deduce the genomic organization of Mycobacterium leprae
    Eiglmeier K, Honore N, Woods SA, Caudron B, Cole ST
    Ref: Molecular Microbiology, 7:197, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer