Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myxxa-Q84FB1

Myxococcus xanthus, Myxococcus fulvus hypothetical protein

Comment
Other strains: Myxococcus xanthus (strain DK 1622), Myxococcus fulvus (strain ATCC BAA-855 / HW-1)


Relationship
Family|ABHD18
Block| X
Position in NCBI Life Tree|Myxococcus xanthus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > delta/epsilon subdivisions: N E > Deltaproteobacteria: N E > Myxococcales: N E > Cystobacterineae: N E > Myxococcaceae: N E > Myxococcus: N E > Myxococcus xanthus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CP000113, AY204469, CP002830
3 UniProt : Q1CXA2, Q84FB1, F8C6F9
3 UniProt : Q1CXA2, Q84FB1, F8C6F9
3 Interpro : Q1CXA2, Q84FB1, F8C6F9
3 Pfam : Q1CXA2, Q84FB1, F8C6F9
3 PIRSF : Q1CXA2, Q84FB1, F8C6F9
3 SUPERFAM : Q1CXA2, Q84FB1, F8C6F9
Sequence
Graphical view for this peptide sequence: myxxa-Q84FB1
Colored MSA for ABHD18 (raw)
MLRTHPVDVLFAGLSRRARLFSQGWGDEQFLEEVAAAAPFQQRPPPIAPE
WSAPRLQRGLQVRDGTFPSPLARLDAAARTAHVRWLSAGQGPSRGACVVL
AASREEGFSLRERMYAPLAREGIDLFLLENPYYGLRRPVGQKGGALRTVS
DHVLMNLGMVDEARALLAWLRSEGHARLGVAGYSMGGYMAALTAAVVPEP
LAVAALAAGASPVPVFTQGLLSWSIAFALLDGPRRDAEQARSRLGRIFDL
ANLARFPPPRQPEAAVLVACRRDGFVPGDETLALHAHWPRSELRWVDAGH
VTALFTERAALCAAIRDALSRVEATT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLRTHPVDVLFAGLSRRARLFSQGWGDEQFLEEVAAAAPFQQRPPPIAPE
WSAPRLQRGLQVRDGTFPSPLARLDAAARTAHVRWLSAGQGPSRGACVVL
AASREEGFSLRERMYAPLAREGIDLFLLENPYYGLRRPVGQKGGALRTVS
DHVLMNLGMVDEARALLAWLRSEGHARLGVAGYSMGGYMAALTAAVVPEP
LAVAALAAGASPVPVFTQGLLSWSIAFALLDGPRRDAEQARSRLGRIFDL
ANLARFPPPRQPEAAVLVACRRDGFVPGDETLALHAHWPRSELRWVDAGH
VTALFTERAALCAAIRDALSRVEATT


References
    Title: Genome sequence of the halotolerant marine bacterium Myxococcus fulvus HW-1
    Li ZF, Li X, Liu H, Liu X, Han K, Wu ZH, Hu W, Li FF, Li YZ
    Ref: Journal of Bacteriology, 193:5015, 2011 : PubMed

            

    Title: Evolution of sensory complexity recorded in a myxobacterial genome
    Goldman BS, Nierman WC, Kaiser D, Slater SC, Durkin AS, Eisen JA, Ronning CM, Barbazuk WB, Blanchard M and Kaplan HB <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 103:15200, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer