Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: nicta-hsr203j

Nicotiana tabacum (Common tobacco) protein for HSR203J protein

Comment
Q9M662 by Suh M.C., Park K.-Y., Choi D. Expression of a novel tobacco gene, Ng-CDM1, is preferentially associated with a biotic cell death. Q8H954 from Kiba A., Tomiyama H., Takahashi H., Ohnishi K., Okuno T., Hikichi Y. Induction of resistance and expression of defense-related genes in tobacco leaves infiltrated with Ralstonia solanacearum


Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Nicotiana tabacum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Solanales: N E > Solanaceae: N E > Nicotianoideae: N E > Nicotianeae: N E > Nicotiana: N E > Nicotiana tabacum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: X77136, CAA54393, AAF62404
3 UniProt : Q43584, Q8H954, Q9M662
1 Ncbi-nid : 444001
3 UniProt : Q43584, Q8H954, Q9M662
3 Interpro : Q43584, Q8H954, Q9M662
3 Prodom : Q43584, Q8H954, Q9M662
3 Pfam : Q43584, Q8H954, Q9M662
3 PIRSF : Q43584, Q8H954, Q9M662
3 SUPERFAM : Q43584, Q8H954, Q9M662
Sequence
Graphical view for this peptide sequence: nicta-hsr203j
Colored MSA for Plant_carboxylesterase (raw)
MVHEKQVIEEVSGWLRVFEDGSVDRTWTGPPEVKFMAEPVPPHDYFIDGV
AVKDVVADEKSGSRLRIYLPERNDNSASKLPVILHFQGGGFCVSHADWFM
YYTVYTRLARAAKAIIVSVFLPLAPEHRLPAACDAGFAALLWLRDLSRQQ
GHEPWLNDYADFNRVFLIGDSSGGNIVHQVAVKAGEENLSPMRLAGAIPI
HPGFVRSYRSKSELEQEQTPFLTLDMVDKFLGLALPVGSNKDHQITCPMG
EAAPAVEELKLPPYLYCVAEKDLIKDTEMEFYEAMKKGEKDVELFINNGV
GHSFYLNKIAVRMDPVTGSETEKLYEAVAEFINKH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVHEKQVIEEVSGWLRVFEDGSVDRTWTGPPEVKFMAEPVPPHDYFIDGV
AVKDVVADEKSGSRLRIYLPERNDNSASKLPVILHFQGGGFCVSHADWFM
YYTVYTRLARAAKAIIVSVFLPLAPEHRLPAACDAGFAALLWLRDLSRQQ
GHEPWLNDYADFNRVFLIGDSSGGNIVHQVAVKAGEENLSPMRLAGAIPI
HPGFVRSYRSKSELEQEQTPFLTLDMVDKFLGLALPVGSNKDHQITCPMG
EAAPAVEELKLPPYLYCVAEKDLIKDTEMEFYEAMKKGEKDVELFINNGV
GHSFYLNKIAVRMDPVTGSETEKLYEAVAEFINKH


References
    Title: Induction of resistance and expression of defense-related genes in tobacco leaves infiltrated with Ralstonia solanacearum
    Kiba A, Tomiyama H, Takahashi H, Hamada H, Ohnishi K, Okuno T, Hikichi Y
    Ref: Plant Cell Physiol, 44:287, 2003 : PubMed

            

    Title: The carboxylesterase gene family from Arabidopsis thaliana
    Marshall SD, Putterill JJ, Plummer KM, Newcomb RD
    Ref: Journal of Molecular Evolution, 57:487, 2003 : PubMed

            

    Title: hsr203J, a tobacco gene whose activation is rapid, highly localized and specific for incompatible plant/pathogen interactions
    Pontier D, Godiard L, Marco Y, Roby D
    Ref: Plant J, 5:507, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer