Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pelts-a5czq3

Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) hydrolases of the alpha/beta superfamily

Comment
only c-term Pfam A BAAT_C 447 873


Relationship
Family|Acyl-CoA_Thioesterase
Block| X
Position in NCBI Life Tree|Pelotomaculum thermopropionicum SI
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Clostridia: N E > Clostridiales: N E > Peptococcaceae: N E > Pelotomaculum: N E > Pelotomaculum thermopropionicum: N E > Pelotomaculum thermopropionicum SI: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : BAAC01000071
1 UniProt : A5CZQ3
1 UniProt : A5CZQ3
1 Interpro : A5CZQ3
1 Prodom : A5CZQ3
1 Pfam : A5CZQ3
1 PIRSF : A5CZQ3
1 SUPERFAM : A5CZQ3
Sequence
Graphical view for this peptide sequence: pelts-a5czq3
Colored MSA for Acyl-CoA_Thioesterase (raw)
ALEISPLQALAGEPWKIRVSGLTPGAPVTLVAEQQDNKGIKWESHAVFHA
DQSGVVDPAVQAPVSGSYEGADPAGLFWSLRPVAGVKPAGTFAKSLEPQM
ITVSVEVEGERILAQEVERLYLLPGVKRVEVRESGVVGTLFLPAGEGRRP
AIIVLGGSDGGTYEPAAAIYASHGYVTLALAYFGMEGLPDSLVNIPLETV
GKAIEWLESRPEVDKDAIGVWGASKGAELALLAASHYPQIKAVVAKSPSA
VVFEGISKDSGKNHQSSWTYKGEPLSFVPTIFTEELAGSYFAAVAKKEPW
STAPLYEYALQNQEAVEKATIKVENINGPVLLVSGGRDGAWPSGKMAEMI
MQRLREKGHPFPDMHLHYRDAGHQISTPYSPTTVYWLTLPGGFIEDLGGT
PEGNAAASMDSWPKIIDFFARHLGGKQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ALEISPLQALAGEPWKIRVSGLTPGAPVTLVAEQQDNKGIKWESHAVFHA
DQSGVVDPAVQAPVSGSYEGADPAGLFWSLRPVAGVKPAGTFAKSLEPQM
ITVSVEVEGERILAQEVERLYLLPGVKRVEVRESGVVGTLFLPAGEGRRP
AIIVLGGSDGGTYEPAAAIYASHGYVTLALAYFGMEGLPDSLVNIPLETV
GKAIEWLESRPEVDKDAIGVWGASKGAELALLAASHYPQIKAVVAKSPSA
VVFEGISKDSGKNHQSSWTYKGEPLSFVPTIFTEELAGSYFAAVAKKEPW
STAPLYEYALQNQEAVEKATIKVENINGPVLLVSGGRDGAWPSGKMAEMI
MQRLREKGHPFPDMHLHYRDAGHQISTPYSPTTVYWLTLPGGFIEDLGGT
PEGNAAASMDSWPKIIDFFARHLGGKQ


Reference
    Title: Reconstruction and regulation of the central catabolic pathway in the thermophilic propionate-oxidizing syntroph Pelotomaculum thermopropionicum
    Kosaka T, Uchiyama T, Ishii S, Enoki M, Imachi H, Kamagata Y, Ohashi A, Harada H, Ikenaga H, Watanabe K
    Ref: Journal of Bacteriology, 188:202, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer