Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: penex-Q9HFW6

Penicillium expansum; Penicillium cyclopium triacylglycerol alkaline lipase (EC 3.1.1.3)

Comment
Other strains: Penicillium expansum, Penicillium cyclopium


Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Penicillium expansum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Penicillium: N E > Penicillium expansum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
3G7N: Crystal Structure of a Triacylglycerol Lipase from Penicillium Expansum at 1.3
No kinetic





1 substrate:
Naproxen
No inhibitor
>3 Genbank links 1 more: AF284064, AF288685, AF330635
1 UniProt : Q7LST4
1 Structure : 3G7N
3 UniProt : Q9HFW6, Q7LST4, Q9P451
3 Interpro : Q9HFW6, Q7LST4, Q9P451
3 Prodom : Q9HFW6, Q7LST4, Q9P451
3 Pfam : Q9HFW6, Q7LST4, Q9P451
3 PIRSF : Q9HFW6, Q7LST4, Q9P451
3 SUPERFAM : Q9HFW6, Q7LST4, Q9P451
Sequence
Graphical view for this peptide sequence: penex-Q9HFW6
Colored MSA for Lipase_3 (raw)
ATADAAAFPDLHRAAKLSSAAYTGCIGKAFDVTIAKRIYDLVTDTNGFVG
YSTEKKTIAVIMRGSTTITDFVNDIDIALITPELSGVTFPSDVKIMRGVH
RPWSAVHDTIITEVKALIAKYPDYTLEAVGHSLGGALTSIAHVALAQNFP
DKSLVSNALNAFPIGNQAWADFGTAQAGTFNRGNNVLDGVPNMYSSPLVN
FKHYGTEYYSSGTEASTVKCEGQRDKSCSAGNGMYAVTPGHIASFGVVML
TAGCGYLS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ATADAAAFPDLHRAAKLSSAAYTGCIGKAFDVTIAKRIYDLVTDTNGFVG
YSTEKKTIAVIMRGSTTITDFVNDIDIALITPELSGVTFPSDVKIMRGVH
RPWSAVHDTIITEVKALIAKYPDYTLEAVGHSLGGALTSIAHVALAQNFP
DKSLVSNALNAFPIGNQAWADFGTAQAGTFNRGNNVLDGVPNMYSSPLVN
FKHYGTEYYSSGTEASTVKCEGQRDKSCSAGNGMYAVTPGHIASFGVVML
TAGCGYLS


References
1 more
    Title: Efficient heterologous expression of an alkaline lipase and its application in hydrolytic production of free astaxanthin
    Huang J, Yang Z, Zhu R, Qian X, Wang Y, Li Y, Li J
    Ref: Biotechnol Biofuels, 11:181, 2018 : PubMed

            

    Title: Crystal structure of a triacylglycerol lipase from Penicillium expansum at 1.3 A determined by sulfur SAD
    Bian C, Yuan C, Chen L, Meehan EJ, Jiang L, Huang Z, Lin L, Huang M
    Ref: Proteins, 78:1601, 2010 : PubMed

            

    Title: Purification and Characterization of an Alkaline Lipase from Penicillium cyclopium PG37
    Wu MC, Wang S, Huang WD, Sun CR
    Ref: Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao (Shanghai), 31:664, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer