Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: phopo-luxd

Photobacterium phosphoreum Photobacterium kishitanii, thioesterase

Comment
Warning: the serine 77 in GXSXG motif is not the active site serine 114 as determined by X ray structure AASLS see Lawson_1994_Biochemistry_33_9382


Relationship
Family|Thioesterase_acyl-transferase
Block| X
Position in NCBI Life Tree|Photobacterium phosphoreum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Vibrionales: N E > Vibrionaceae: N E > Photobacterium: N E > Photobacterium phosphoreum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: phopo-luxd
Colored MSA for Thioesterase_acyl-transferase (raw)
MKSENNSVPIDHVIKVDNERHIRVWETFPKNQCDKRNNTIVIASGFARRM
DHFAGLAEYLSTNGFHVIRYDSLNHVGLSSGEIDQFSMSVGKKSLLTVID
WLKSEHGIDQVGLIASSLSARIAYDIVADVNLSFLITAVGVVNLRNTLEQ
ALKYDYLQMEIDEIPEDLDFDGYNLGSKVFVTDCFENNWDTLDSTINKTK
NLNVPFIAFVANDDSWVQQHEVEELMSNINSDKTKIYSLIGSSHDLGENL
IVLRNFYQSITKAAIALDSNLVGLVSEIIEPQFEALTIATVNERRLKNKI
QSKSLA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKSENNSVPIDHVIKVDNERHIRVWETFPKNQCDKRNNTIVIASGFARRM
DHFAGLAEYLSTNGFHVIRYDSLNHVGLSSGEIDQFSMSVGKKSLLTVID
WLKSEHGIDQVGLIASSLSARIAYDIVADVNLSFLITAVGVVNLRNTLEQ
ALKYDYLQMEIDEIPEDLDFDGYNLGSKVFVTDCFENNWDTLDSTINKTK
NLNVPFIAFVANDDSWVQQHEVEELMSNINSDKTKIYSLIGSSHDLGENL
IVLRNFYQSITKAAIALDSNLVGLVSEIIEPQFEALTIATVNERRLKNKI
QSKSLA


References
4 more
    Title: Photobacterium kishitanii sp. nov., a luminous marine bacterium symbiotic with deep-sea fishes
    Ast JC, Cleenwerck I, Engelbeen K, Urbanczyk H, Thompson FL, De Vos P, Dunlap PV
    Ref: Int J Syst Evol Microbiol, 57:2073, 2007 : PubMed

            

    Title: Lateral transfer of the lux gene cluster
    Kasai S, Okada K, Hoshino A, Iida T, Honda T
    Ref: J Biochem, 141:231, 2007 : PubMed

            

    Title: A lux-specific myristoyl transferase in luminescent bacteria related to eukaryotic serine esterases
    Ferri SR, Meighen EA
    Ref: Journal of Biological Chemistry, 266:12852, 1991 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer