Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: picsi-a9np95

Picea sitchensis (Sitka spruce) (Pinus sitchensis) Putative uncharacterized protein

Relationship
Family|RsbQ-like
Block| X
Position in NCBI Life Tree|Picea sitchensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Acrogymnospermae: N E > Pinidae: N E > Pinales: N E > Pinaceae: N E > Picea: N E > Picea sitchensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : EF083105
1 UniProt : A9NP95
1 UniProt : A9NP95
1 Interpro : A9NP95
1 Pfam : A9NP95
1 PIRSF : A9NP95
1 SUPERFAM : A9NP95
Sequence
Graphical view for this peptide sequence: picsi-a9np95
Colored MSA for RsbQ-like (raw)
MAEESKLLGVLNVKIIGSGKPTLVLAHGFGSDQSVWQYILPYLVAHYKVI
VFDMVFSGKVDPKNFDFDRYTSLSAYAADLLSILDELKIDKCLYVGHSVS
GMVGCLASIERPELFERLILLCASPRYLNEESYHGGFERGEVDSLYYALK
SHYAAWASGFAPLAVGVDEPSVVEEFRRTMMNMKPEIALAVAKTIFESDM
RSILCDVKTPCSIIQTAKDIVVPMAVPYHMQGNLGGKMNSVIILDAEGHL
PQLTAQDLLLQAVKLILEGSKMVLEPTVQNANI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAEESKLLGVLNVKIIGSGKPTLVLAHGFGSDQSVWQYILPYLVAHYKVI
VFDMVFSGKVDPKNFDFDRYTSLSAYAADLLSILDELKIDKCLYVGHSVS
GMVGCLASIERPELFERLILLCASPRYLNEESYHGGFERGEVDSLYYALK
SHYAAWASGFAPLAVGVDEPSVVEEFRRTMMNMKPEIALAVAKTIFESDM
RSILCDVKTPCSIIQTAKDIVVPMAVPYHMQGNLGGKMNSVIILDAEGHL
PQLTAQDLLLQAVKLILEGSKMVLEPTVQNANI


Reference
    Title: A conifer genomics resource of 200,000 spruce (Picea spp.) ESTs and 6,464 high-quality, sequence-finished full-length cDNAs for Sitka spruce (Picea sitchensis)
    Ralph SG, Chun HJ, Kolosova N, Cooper D, Oddy C, Ritland CE, Kirkpatrick R, Moore R, Barber S and Bohlmann J <5 more author(s)>
    Ref: BMC Genomics, 9:484, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer