Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pig-acph

Sus scrofa domestica (domestic pig) mRNA for acylamino acid-releasing enzyme (EC 3.4.19.1)

Comment
Belongs to peptidase family s9C


Relationship
Family|ACPH_Peptidase_S9
Block| X
Position in NCBI Life Tree|Sus scrofa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Suina: N E > Suidae: N E > Sus: N E > Sus scrofa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
7PX8: CryoEM structure of mammalian (Sus scrofa pig) acylaminoacyl-peptidase
No kinetic





No Substrate
No inhibitor
2 Genbank : D00524, CU914539
3 UniProt : P19205, Q7M326, F1SPS7
1 Ncbi-nid : 217671
1 Ncbi-pid : 217672
1 Structure : 7PX8
3 UniProt : Q7M326, P19205, F1SPS7
3 Interpro : Q7M326, P19205, F1SPS7
3 Prodom : Q7M326, P19205, F1SPS7
3 Pfam : Q7M326, P19205, F1SPS7
3 PIRSF : Q7M326, P19205, F1SPS7
3 SUPERFAM : Q7M326, P19205, F1SPS7
Sequence
Graphical view for this peptide sequence: pig-acph
Colored MSA for ACPH_Peptidase_S9 (raw)
MERQVLLSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGRYRTVHTEW
TQRDLERMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSG
TMKAVLRKAGGTGTAEEKQFLEVWEKNRKLKSFNLSALEKHGPVYEDDCF
GCLSWSHSETHLLYVADKKRPKAESFFQTKALDVTGSDDEMARTKKPDQA
IKGDQFLFYEDWGENMVSKSTPVLCVLDIESGNISVLEGVPESVSPGQAF
WAPGDTGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLTGGKCELLSDESV
AVTSPRLSPDQCRIVYLRFPSLVPHQQCGQLCLYDWYTRVTSVVVDIVPR
QLGEDFSGIYCSLLPLGCWSADSQRVVFDSPQRSRQDLFAVDTQMGSVTS
LTAGGSGGSWKLLTIDRDLMVVQFSTPSVPPSLKVGFLPPAGKEQAVSWV
SLEEAEPFPDISWSIRVLQPPPQQEHVQYAGLDFEAILLQPSNSPEKTQV
PMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILS
LPGNVGHQDVKDVQFAVEQVLQEEHFDAGRVALMGGSHGGFLSCHLIGQY
PETYSACVVRNPVINIASMMGSTDIPDWCMVEAGFSYSSDCLPDLSVWAA
MLDKSPIKYAPQVKTPLLLMLGQEDRRVPFKQGMEYYRVLKARNVPVRLL
LYPKSTHALSEVEVESDSFMNAVLWLCTHLGS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MERQVLLSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGRYRTVHTEW
TQRDLERMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSG
TMKAVLRKAGGTGTAEEKQFLEVWEKNRKLKSFNLSALEKHGPVYEDDCF
GCLSWSHSETHLLYVADKKRPKAESFFQTKALDVTGSDDEMARTKKPDQA
IKGDQFLFYEDWGENMVSKSTPVLCVLDIESGNISVLEGVPESVSPGQAF
WAPGDTGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLTGGKCELLSDESV
AVTSPRLSPDQCRIVYLRFPSLVPHQQCGQLCLYDWYTRVTSVVVDIVPR
QLGEDFSGIYCSLLPLGCWSADSQRVVFDSPQRSRQDLFAVDTQMGSVTS
LTAGGSGGSWKLLTIDRDLMVVQFSTPSVPPSLKVGFLPPAGKEQAVSWV
SLEEAEPFPDISWSIRVLQPPPQQEHVQYAGLDFEAILLQPSNSPEKTQV
PMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILS
LPGNVGHQDVKDVQFAVEQVLQEEHFDAGRVALMGGSHGGFLSCHLIGQY
PETYSACVVRNPVINIASMMGSTDIPDWCMVEAGFSYSSDCLPDLSVWAA
MLDKSPIKYAPQVKTPLLLMLGQEDRRVPFKQGMEYYRVLKARNVPVRLL
LYPKSTHALSEVEVESDSFMNAVLWLCTHLGS


References
2 more
    Title: Cryo-EM structure of acylpeptide hydrolase reveals substrate selection by multimerization and a multi-state serine-protease triad
    Kiss-Szeman AJ, Straner P, Jakli I, Hosogi N, Harmat V, Menyhard DK, Perczel A
    Ref: Chem Sci, :, 2022 : PubMed

            

    Title: Complete covalent structure of porcine liver acylamino acid-releasing enzyme and identification of its active site serine residue
    Miyagi M, Sakiyama F, Kato I, Tsunasawa S
    Ref: J Biochem, 118:771, 1995 : PubMed

            

    Title: The primary structure of porcine liver acylamino acid-releasing enzyme deduced from cDNA sequences
    Mitta M, Asada K, Uchimura Y, Kimizuka F, Kato I, Sakiyama F, Tsunasawa S
    Ref: J Biochem, 106:548, 1989 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer